CAZyme Information: MGYG000000043_02997

Basic Information

• Species: Phocaeicola sp900066455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066455
• CAZyme ID: MGYG000000043_02997
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		97064.9	6.1927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000043	4183533	Isolate	United Kingdom	Europe

• Gene Location: Start: 5358; End: 7922 Strand: +

Full Sequence      

MKMNHYAKCVTTGILCTFMYGTLSAQETDFDLSSQRSEKQDVLAVPGKKIDHKGLIINPT
PHQMKLDANNTCPITQGIYLKDKQQKFAASLDFLTQNKKGIKLTIDFGAKAAGKANVKQI
SGAYSLVIGKKEITIIGYDARGAFYGIQTLKQLTESPVSAHGTLPCMEINDYPDLPNRGV
VEGFYGTPWSHEVRLSLIDFYGKFKMNTYLYGPKDDPYHSCPNWRLPYPEKEAQHIKELV
DASNRNYVDFVWAIHPGQDIKWNEEDYHNLLQKFNWMYDLGVRHFAIFFDDISGEGTNPL
KQTELLNRLTEEFVKVKGDVSPLTVCPTDYSKLWANPTEKGSLAIYGKTLNPEIKVFWTG
DVVCSDLTPETLDFINSRIKRPAYYWWNYPVTDYIRNFLLQGPVYGLDTSLTAQETCGVI
SNPMEHGEASKLALYGVADYAWNIADYNAIDNWERGLAELVPDATEAYRTFAIHSSDTEN
GYRRDESWETKTFRIADWNDAAANALEEEFKKVESVPARMENGCKNKALLNELRPWLTEF
GKLGTRGKQAIELARIYRSGQDDALFWTKYIQNIMTPEDRKNYEAHKSGTLKLQPFYEYA
MDDMAHGYLKKLSGKVPTDYKGIGSFSSAHTVQTKLMFDNDSTTFYTSGIAQKPNDWIGV
DLRDVRDVTEISILQGRNSKDDVDYFDHAVVECSADGQNWKALTGELNQQYIIHWQGTPE
KARYVRLKRLDSKRTNYASVRSFDVNPLRPDNLGFTLEADTLSKAVYAFDNNLATSYQST
KAIAFEVDKDVKAYTLLMNQLSAPIKCVQLDKKGKILSETMIETPYARIELADKNVCQIR
LEGKVEIFEIVPIK

Enzyme Prediction     

No EC number prediction in MGYG000000043_02997.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	178	472	7.7e-106	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.20e-168	178	471	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	2.94e-13	59	171	6	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	8.57e-08	638	728	18	111	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
COG3525	Chb	1.38e-07	57	232	136	316	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd00057	FA58C	6.02e-06	638	727	29	126	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALB75783.1	0.0	1	853	1	852
ADV43394.1	0.0	6	851	3	847
BCI62100.1	0.0	1	852	1	853
AHF11939.1	0.0	8	854	6	855
BBL05673.1	0.0	1	851	1	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MI4_A	2.64e-154	97	570	62	539	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	3.66e-154	97	570	50	527	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	3.77e-154	97	570	51	528	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2CHO_A	3.77e-154	97	570	51	528	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	3.77e-154	97	570	51	528	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	3.86e-153	97	570	72	549	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	1.65e-93	1	732	1	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	3.16e-93	1	732	1	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	3.39e-49	133	754	143	803	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q8VIJ5	1.43e-33	179	450	63	339	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000543	0.998318	0.000579	0.000183	0.000177	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000043_02997.