CAZyme Information: MGYG000000043_03311

Basic Information

• Species: Phocaeicola sp900066455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066455
• CAZyme ID: MGYG000000043_03311
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000000043_63|CGC1	37942.23	4.7428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000043	4183533	Isolate	United Kingdom	Europe

• Gene Location: Start: 3747; End: 4766 Strand: -

Full Sequence      

MICMKKFVCVVLAAFGLAACSVKQTETVPTPSKQLHPWVVYGEESSFADLEPVKDMIASV
SVFGNPPREYIDKCHAAGIEVYRAVGGNEESINTPEKIASLVESYVNDCQANGYDGIDLD
FEHLSPSVRATYSDFLQKASAALHAAGKKMSHCVGFYPALYADENTQIFYDPAVLENTCD
LVRVMCYDMYCAPCIGVKELAHRDDCQGVGPTSNYLWTRECMLYWKERISADKLVMALPA
YGNDYKLTGDIAGTQIYAPKPDKAVGELPAPTWLCYEKVNMYLYDHEDGCRHLFYAADAR
STECLLQLADELQLPKVGFWHFSSVSPDTWKVTRDWMEK

Enzyme Prediction     

No EC number prediction in MGYG000000043_03311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	55	323	1.6e-30	0.777027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.18e-29	66	332	46	312	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.37e-21	101	335	195	420	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	2.41e-15	84	323	69	305	Glycosyl hydrolases family 18.
smart00636	Glyco_18	4.82e-15	84	323	72	332	Glyco_18 domain.
cd06545	GH18_3CO4_chitinase	4.03e-14	68	249	49	216	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT74215.1	8.99e-158	23	339	11	327
QUR45688.1	5.18e-157	23	339	11	327
QDH57494.1	5.18e-157	23	339	11	327
QUT79492.1	2.68e-156	23	339	8	324
QDM10145.1	2.98e-156	23	339	11	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JH8_A	4.29e-11	99	302	90	279	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4Q6T_A	2.23e-10	99	247	99	242	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	2.03e-10	112	334	130	340	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000056	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000043_03311.