CAZyme Information: MGYG000000044_00209

Basic Information

• Species: Parabacteroides merdae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides merdae
• CAZyme ID: MGYG000000044_00209
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	MGYG000000044_1|CGC4	33446.04	6.8909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000044	4300426	Isolate	United Kingdom	Europe

• Gene Location: Start: 251180; End: 252040 Strand: -

Full Sequence      

MKNKFYLYCILCFLFNVAGYSQSTVFESLSFESNKLGRKVSYSIYLPSDYNTSKRNYPVL
YLLHGYTDNETNWIQMGQMKTIADRAIANEEAVPMIIVMPDAWDTWYINQYDGKVPYEDM
FFEELIPYMEKTYRIRSDKESRAIAGLSMGGYGSFLYSLHHPDMFCACAPLSAAVFDDTV
MEARKNKSHKDLFNRLFGPGDEHWKQNNVLKILSDWNQNNLPKIRYYIDCGDDDGLLDGN
MQVHQVMKQKGIRHEFRVRDGGHSWTYWRTALPEVLRFVSQTFCRS

Enzyme Prediction     

No EC number prediction in MGYG000000044_00209.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	280	1.1e-62	0.9823788546255506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	4.34e-40	33	278	75	294	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	2.90e-35	33	278	1	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	9.62e-31	40	283	35	312	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	1.31e-09	26	280	9	259	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG4099	COG4099	1.87e-09	26	172	160	301	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF40860.1	1.82e-38	31	272	149	374
AMQ56447.1	2.95e-35	31	272	148	377
BCS34250.1	7.47e-34	31	272	110	335
QJW99051.1	1.70e-33	27	275	276	501
BBL01057.1	2.19e-33	27	274	148	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.63e-54	33	283	19	272	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
1JJF_A	5.73e-27	44	281	50	259	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.55e-26	44	281	50	259	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
4RGY_A	4.52e-25	31	279	9	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
6RZN_A	1.35e-24	31	274	137	379	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	3.93e-27	44	276	449	665	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	1.05e-24	44	281	69	278	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P23553	3.07e-20	29	281	6	263	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
D5EY13	9.73e-20	27	275	501	720	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P9WM38	2.36e-16	31	263	179	425	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002243	0.996671	0.000403	0.000211	0.000211	0.000217

TMHMM  Annotations     

start	end
7	26