CAZyme Information: MGYG000000044_00735

Basic Information

• Species: Parabacteroides merdae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides merdae
• CAZyme ID: MGYG000000044_00735
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	MGYG000000044_1|CGC14	85973.36	5.4662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000044	4300426	Isolate	United Kingdom	Europe

• Gene Location: Start: 861257; End: 863515 Strand: +

Full Sequence      

MKLKLLLLTFILVCTGCKNDPRIQAAYDLIERVTPGYGKQFKLELMEPVDGMDAYEITSD
NGKVVLRGNNTVSLATAFNQYLKYTCNAHVSWFGNQLDLPKQLPMPVPVKNTINGKYRIY
MNYCTVSYSAAWWDWERWQRELDFMAMNSINMPLSVVGLEAVWYNTLLKHKFTDEEARRF
LAGPGHFAWQWMQNLQSYGGPLPKSWIDKHIVLGKQIIDRELELGMQPIQQGFSGYVPRE
LKEKYPDAKIQLQPSWCGFTGAAQLDPTDSLFTVIGRDFLEEEKKLYGAHGVYAADPFHE
SQPPVDTPEYLSAVGNSIHKLFNDFDPNSIWAMQAWSLREPIVKAVPKENLLILDLNGAK
SQQENACWGYPLVAGNLHNFGGRINLHGDLRLLASNQYVNAVKKNPNVCGSGLFMESIEQ
NPVYYDLAFEMPLHKDEVNIEEWLCRYADRRYGRPSENAHQAWLHLLEGPYRPGTNGTER
SSIIAARPAVNVKKSGPNAGLGIPYSPLLVVQAEGLLLKDAGRLKGSDPYRFDIVDVQRQ
LMSNLGQAIHKQAAEAFRKKDKEAFTLHSSRFLEMLRDADELLRTRPEFNFDKWLTQARS
WGNNNEEKDLFEKDATALVTVWGADGDPLIFDYSWREWTGLIDGYYLKRWEKFYAMLQDH
LDAGTSYNEEGLPQTHGREAFRANDFYSALGDWELQFVSSPDKVRTPITQGDEVETATRL
YKKYVRLAAEYYKDEIEADEIHEGNIFENLGE

Enzyme Prediction     

No EC number prediction in MGYG000000044_00735.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	61	723	6.7e-204	0.9969834087481146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	3.73e-151	118	432	1	330	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.51e-80	443	717	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	5.65e-35	24	104	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48266.1	0.0	1	752	1	752
QQT79630.1	0.0	1	752	1	752
QUU09704.1	0.0	1	752	1	752
ASM67128.1	0.0	1	752	1	752
QRP58487.1	0.0	1	752	1	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	3.86e-120	19	664	167	831	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	4.63e-120	19	664	175	839	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	4.89e-119	19	664	190	854	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	1.09e-116	51	724	38	711	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	4.94e-116	25	724	48	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	1.09e-115	16	724	20	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000066	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000044_00735.