CAZyme Information: MGYG000000044_02100

Basic Information

• Species: Parabacteroides merdae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides merdae
• CAZyme ID: MGYG000000044_02100
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	MGYG000000044_4|CGC8	78450.01	6.3871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000044	4300426	Isolate	United Kingdom	Europe

• Gene Location: Start: 381278; End: 383317 Strand: +

Full Sequence      

MNKLKKIFLTAVATLTVATVSAAGEEPAAESYRNNRHPLLQKDYIQLPLGTIRAEGWMHD
QLTRMRDGMTGHLDKVYTKVMGPRNGWLGGDGDVWERGPYWIDGLLPLAYLLNDQALIEK
VQPWIEWTLASQKPNGYFGPDTDRDYEPGLQRNNAQDWWPKMVMLKVMQQYYTATQDRRV
IDFMTRYFRYQLDELPKNPLGKWTFWGEQRGGDNLMVVYWLYNITGDKFLLDLGELIHKQ
TFNWTDIFLNQNHLRRQHSLHCVNLAQGFKEPIVYYQQGKDSKQIQATRQAVNDIRHTIG
LPTGLWGGDELLRFGKPTTGSELCTAVEMMYSLETILEVTGDMQWADYLERVAYNALPTQ
VTDDYSARQYYQQTNQIAVTREWREFSTPHDDTDLLFGELTGYPCCTSNLHQGWPKFVQN
LWYATADNGLASLLFAPSQVTARVAGGIEVNLKEETAYPFEETVRYHVSFTDKKVKKVFF
PFHLRIPGWCKQPVVKLNGKPLTVDAYPGTVTRINREWKEGDILSLELPMEVTVSRWYEN
SAVVERGPLVYALKMNEKWEKKAFESDKSDVYGKWYYEVTSDSPWNYALPARSFSPDRIK
DAFTVEKSDITTPYPWNVENAPIRIKTKAMRLNGWTQVRGSAGPVPYYTQQGKDFGDEET
IELIPYGCTTLRITEFPVR

Enzyme Prediction     

No EC number prediction in MGYG000000044_02100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	168	552	1.8e-36	0.7236580516898609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	8.72e-68	85	552	51	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.30e-31	114	604	84	566	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL07583.1	1.06e-155	1	678	1	650
ACU60445.1	3.09e-154	22	678	18	650
AMP98056.1	1.01e-152	1	678	1	650
ATP55412.1	2.91e-152	1	678	1	650
QNK64903.1	5.32e-152	23	678	13	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	6.57e-22	314	553	367	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	1.97e-18	101	553	82	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.29e-16	101	553	82	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	9.33e-13	119	551	89	544	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
6YQH_AAA	1.42e-12	224	536	229	542	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000255	0.999037	0.000186	0.000175	0.000165	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000044_02100.