CAZyme Information: MGYG000000044_03581

Basic Information

• Species: Parabacteroides merdae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides merdae
• CAZyme ID: MGYG000000044_03581
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000000044_14|CGC1	42915.15	6.8482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000044	4300426	Isolate	United Kingdom	Europe

• Gene Location: Start: 13476; End: 14570 Strand: -

Full Sequence      

MEKKAWLICICCLCCMCGVSAPKKNNFSVKRGVNISHWLSQSNVRGENRAVFFTEADVKF
LSEVGFDHLRLPVDEEQMFAPDGSKEKEAFSLLHNALSWCQKYRLKAIVDLHILRSHHFN
AKEKPLFTDRKEQIRFYDLWKQLSQELHTYSVDFLAYELMNEPVADDHEQWNNIVAECVR
TIRLLEPERSLLVGSNRWQGYETMRYLKIPENDPNLIISFHYYNPFLLTHYRAGWTDVKD
YTGKVHYPGKLIADEDLKHLKGELYDKFSYWNKVEFNKEVIEKHFKEVVDFARLHQLPLY
CGEFGCIAATPKADKERWYQDMIELFDKYEIARANWDYKGGFGIIEQGIPQTDLIYILTG
RNIK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	32	340	2.3e-138	0.9935897435897436

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.55e-27	54	338	26	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.83e-09	30	344	52	359	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50630.1	2.76e-167	147	364	1	218
SMD43874.1	1.35e-134	23	358	28	364
QMU29539.1	3.40e-132	27	363	42	385
QNF33991.1	1.19e-131	27	363	45	388
AXT60837.1	6.82e-126	27	362	24	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	4.23e-63	28	339	3	316	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.18e-62	28	339	3	316	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	2.01e-32	22	362	5	314	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AOF_A	1.04e-31	22	362	5	314	Crystalstructures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8],3AOF_B Crystal structures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8]
3AMG_A	1.45e-31	22	362	5	314	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	2.10e-63	28	339	3	316	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	2.10e-63	28	339	3	316	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	1.01e-60	28	339	3	316	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	3.12e-43	31	333	9	288	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P14250	4.24e-25	29	348	310	643	Endoglucanase 3 OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) OX=59374 GN=cel-3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.019640	0.716874	0.262345	0.000430	0.000342	0.000362

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000044_03581.