CAZyme Information: MGYG000000045_01285

Basic Information

• Species: Faecalibacillus intestinalis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Faecalibacillus; Faecalibacillus intestinalis
• CAZyme ID: MGYG000000045_01285
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489		56474.33	4.5941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000045	2722761	Isolate	United Kingdom	Europe

• Gene Location: Start: 89594; End: 91063 Strand: -

Full Sequence      

MSFPKGFLWGGDISANQCEGGWDEGGKSPNMTDYHTGGNVNEPRMATYIMPDGTYGKTPA
MIENCNLPEGAKLAINPDEFYPNHKATDFYHHYKEDIAMFAELGFKAFNMTLSWARIFPK
GIKAGINPEGVEFYHNVFKECLKYGIEPLVHLYKYDMPAFYIEELGGWKNRVLIDEFVEF
GKASIDEFQEVTYWSTFNEINAAQFSILDSSNQEEVQRQYQVLHNQLVASAKVVKYLHDN
YPNKKIGCMQAGIFTHALTCDPEDELANQKEMQTNFWYAGDVFVRGYYPSYAKHLWKELN
ITLDITEEDTKALKEGTVDFFEFSYYFSNCVTTHLDGEEATGNLNFMSKKNPYLKESDWG
WAIDPKGLKFFMHEIYDRYQIPLMNCENGLGAFDILEEDGRVHDQYRIDYMREHVKAMSE
GIDEGVDLMGYTWWGCIDLVSASTGEIRKRYGFIYVDVDDFGNGTYKRYKKDSFEYCKKV
YTSNGEDLD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	485	1.2e-127	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	1.85e-178	1	488	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	3.90e-175	2	489	3	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	1.22e-173	1	489	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	1.83e-165	1	489	4	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	6.32e-150	1	488	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30708.1	4.00e-201	1	489	1	489
QHB24556.1	1.62e-200	1	489	1	489
QEI32059.1	1.62e-200	1	489	1	489
ASY54796.1	1.74e-200	1	488	1	491
AUW96249.1	2.11e-194	1	489	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	4.18e-147	4	488	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.19e-146	4	488	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	1.70e-143	1	488	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3PN8_A	7.08e-143	4	488	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
6WGD_A	7.96e-142	3	488	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	2.14e-145	3	489	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46829	9.34e-143	1	488	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.06e-141	2	488	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	1.13e-138	3	488	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	3.61e-130	1	489	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999425	0.000624	0.000006	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000045_01285.