CAZyme Information: MGYG000000045_01854

Basic Information

• Species: Faecalibacillus intestinalis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Faecalibacillus; Faecalibacillus intestinalis
• CAZyme ID: MGYG000000045_01854
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
885	MGYG000000045_9|CGC1	101753.13	8.1737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000045	2722761	Isolate	United Kingdom	Europe

• Gene Location: Start: 6224; End: 8881 Strand: +

Full Sequence      

MIILVDICKYIILCDVITLLKANRISKLKYSIDLKYCRRLEMKKKYISLFLVILLGMIFN
ISNIKAYEETNEVIGQTKFVDKDGNINTVDVYDGTTNEEYNPYARTVSTANMVNFNCSKA
KTTTNFTDYYTGQEGYLSKSNAADAAFLGYENGKVKFMISGIVGLVDPQYVEVLSQGTYY
ASNYEVNSSGDLYHYISNNVNATGNQGNKNYIGTGPSYLTKNKEYYSYDGHYFYDNYNTM
ITDYKNNVRNNAVNPNNPYYSYFQYLPMRSQTTYTGSQISNYLNNKAGSTSKLYNTGDIF
IKYQNKYGVNALMAASFAALESGWGKSNIALNKNNLFGLNATDNNPGGNADTFSTVDDCI
MNFTSSWMSKRYLNPTYTSLFRGGYFGDKGSGIFGKYSSDPYEGEKCASIAKNMDASISS
KDNDYYTLGIKDIYLTTHTALNVRSSSNTNSSVLYTTIKNPAYSFIIKDASAINDFYKIQ
SEVASSDGTYSFDNTGYVSNQYVTLLNNTSHPQGWKKENNYWYYYFSNGSKATGLQTIEN
NLYYFNTSGQMQTGWQEVNNKWYYFDELGYGQKDWKLIGNNWFYFNSSYQMQTGWQEINE
KWYYLSTGVMNIYGKTYYEGYMVTGWLPLGNDWYYLNSDGSMVTGLQTVGNNFYYFNASG
KMQTGWQGINNKWYYFDNGGYGQKSWQMIAGNTYYFLDNYQMATGFQEISGNTYFFSTGV
MNIYGKTYYEGYMVTGWLTLGSDWYYFDSTGKRLTGLQKVGNNLFYFNDSGKMQTGWQKV
SNKWYYFDDSGYGQSGWKKLGNTWFYFNSQYQMLTGWQRINGKWYYLSTGVMEIYGKTYY
EGYMVTGWLQLENKWYYLKSDGSMVTGYYKVGNKTYYFNSSGVMQ

Enzyme Prediction     

No EC number prediction in MGYG000000045_01854.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	297	414	1.5e-18	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	6.21e-50	592	884	442	642	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	1.36e-49	514	791	444	640	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	7.65e-44	704	885	443	622	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	1.21e-42	508	695	456	635	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.44e-42	514	695	487	658	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL58959.1	0.0	1	863	1	863
QPS13527.1	1.19e-215	60	508	56	514
QMW73215.1	1.19e-215	60	508	56	514
QQV05342.1	1.86e-204	65	507	85	537
QQY27665.1	3.58e-202	66	507	80	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2W_A	1.26e-21	151	422	56	290	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P59205	2.32e-20	151	422	424	658	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	2.58e-20	151	422	468	702	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.967330	0.023329	0.008754	0.000318	0.000080	0.000183

TMHMM  Annotations     

start	end
46	64