CAZyme Information: MGYG000000045_01855

Basic Information

• Species: Faecalibacillus intestinalis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Faecalibacillus; Faecalibacillus intestinalis
• CAZyme ID: MGYG000000045_01855
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
758	MGYG000000045_9|CGC1	88039.2	5.4495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000045	2722761	Isolate	United Kingdom	Europe

• Gene Location: Start: 8908; End: 11184 Strand: +

Full Sequence      

MKKFFGYLFLVFGMAFALSYFQNSSVNALDGSYDDAIMGQSSHIDQDENKIEDAKEENSY
SLRTMIQNGWFYQGNKKCFRDNDGHVIGENVKKVIDVSQYNGHIDWSKVSKTDVDGVIIR
IVSHKGGYYHIDKQFENNLNGCRKYNIPFGIYIYDYSNNVTDADNEAKMILNYLSIYKIS
PSELSYPVYLDMERPELSTTTNELVVDAFVNKLANSNYNTKVYSYRSLLQTKLNSPTIYQ
HVDWVAAYTSSLGFSNNWYRGPKGWQYSNGAFVDGISGYVDMSVWYDQGVSKYDYVGWKY
YYDHWYYGSSKNILQIGWEKINGKWYYFNTNGIMATGWISLNGEWYYLTSNGDMVTGAQT
INNKEYYFTSEGVMVRGWHKENDKWKYYSPKKMSIYGRTFVEGEKVTGWLPINDKWYYIA
EDGYMVTGIYKVGNRKYLFMEDGSMKTGWFKVDDTWYYISSDGELRAQWVKSLSNWYYVN
DEGLILTGDQVINGRQYYFNEDGIMYTGWMQVGNQWKYYSQGTLKIYGKTFVDGEKVTGW
LPLGNRWYYIANDDYMVTGYYKVGNSTYYFDESGLMKTGWFKINGEDYYAASSGAIQAQW
VKSLSNWYYVDVDGKMVTGYQTINGAKYYFASSGLMQKDWFKINGEDYYAASSGAIQAQW
VKSLSNWYYVDVDGKMVTGYQTINGAKYYFASSGLMQKDWFKINGEDYYAASSGTIQAQW
VKSGRNWYYVDTDGKMVTGDYIIDGTVNRFDNQGLWMN

Enzyme Prediction     

No EC number prediction in MGYG000000045_01855.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	95	276	1.1e-32	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	6.73e-51	92	286	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
NF033930	pneumo_PspA	3.98e-50	262	503	441	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	3.14e-49	317	617	444	660	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	6.85e-45	538	748	443	654	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	6.72e-44	262	483	484	663	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL58958.1	6.85e-232	1	758	1	698
QQV05342.1	2.90e-65	62	286	1473	1699
QPS13527.1	9.91e-59	62	286	1434	1660
QMW73215.1	9.91e-59	62	286	1434	1660
QQY27665.1	5.89e-58	62	286	1479	1710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	9.36e-47	69	286	245	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	2.39e-46	69	286	245	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
5A6S_A	4.72e-09	88	283	18	199	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000630	0.998591	0.000219	0.000198	0.000170	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000045_01855.