CAZyme Information: MGYG000000046_01416

Basic Information

• Species: Megasphaera stantonii
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera stantonii
• CAZyme ID: MGYG000000046_01416
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560		62698.01	8.4716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000046	2558124	Isolate	United Kingdom	Europe

• Gene Location: Start: 59096; End: 60778 Strand: -

Full Sequence      

MKHTSRLRTLCLASLLAVSLQVVVAASGGEAVSEQAVPDRGPWAAIPRAAVPAAAEQPAS
MAIREEEGRWLVSEKALQEYGLYRADAKKGTYWLRLPPAKDGSILWKDMQAALRLPARQG
DGETSLNIRRIYRTLGLPLTWEDGKRELLRPVSPTRLAPTLRLLEDSDRAAATAKADTKK
EKKKDKKSRKKQAQERKMGLVLFWDPLMQGDENLPPLDTAQPVMSPCAFRLTAQGVALRH
DDFAMLADAYAAKGYAMWPLIDNNFDPALTHAVLSDDKLQDRIIKELIGYALLYDFKGYN
IDFENINYDDKDRLTAFVGRLSRACRAYGLKLSMDVTPISNSMNWSRVYDRAALAPHLDY
LMIMAYDQFSRTSDIAGPVASYPWVEKAVQNVTAIVPAEKVVLGMPLYMRLWYETTEEQD
LPLDINEWPPVAGTEGAAEKDAAAEALTTSRKAEAKGKTAASKEAKPKKPVLLVRTLPMS
ASGLLLEKYKDYVTWNDELGLYYMDLPLTTGRVQVWFEDEKSLTEKAKLITKYNLGGASF
WRKGFEAPHFWQSFAPQELT

Enzyme Prediction     

No EC number prediction in MGYG000000046_01416.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	270	544	3.3e-36	0.7027027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.34e-59	212	551	21	310	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.45e-38	253	551	159	415	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	8.94e-24	271	541	83	329	Glyco_18 domain.
pfam00704	Glyco_hydro_18	8.01e-20	271	541	80	302	Glycosyl hydrolases family 18.
cd02875	GH18_chitobiase	6.59e-14	298	541	115	334	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL22119.1	0.0	1	560	1	558
CCC74348.1	8.41e-199	1	560	1	588
AVO74965.1	8.41e-199	1	560	1	588
AVO27694.1	2.39e-198	1	560	1	588
ALG42233.1	1.94e-197	1	560	1	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q6T_A	7.75e-20	265	551	83	332	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
3CZ8_A	1.26e-15	260	412	76	228	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	2.35e-14	229	551	33	307	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4WIW_A	5.94e-12	241	412	60	239	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
4S3J_A	3.58e-10	262	552	178	419	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31682	2.36e-20	202	423	11	224	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
O32258	3.12e-18	253	553	83	338	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	3.80e-15	260	542	168	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P37531	3.58e-10	265	557	178	422	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	8.34e-10	262	552	177	418	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003785	0.992749	0.002804	0.000233	0.000202	0.000198

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000046_01416.