CAZyme Information: MGYG000000046_01582

Basic Information

• Species: Megasphaera stantonii
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera stantonii
• CAZyme ID: MGYG000000046_01582
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	MGYG000000046_13|CGC1	60877.91	9.3587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000046	2558124	Isolate	United Kingdom	Europe

• Gene Location: Start: 31629; End: 33242 Strand: -

Full Sequence      

MKHRPVFFLLAVLCFLFLLLGNSQLAVTDPVESNYALTAKEMVLSGDWISPQIYGTYWFD
KPIFIYWMLCISYTLCGFTDFASRLPGALFGTASVVLAAWYMLRRTGRMTAALIVAAMTV
TSLAVWAISHSIITDQMLFFFTSAAMFFAYIGLTEGKKWYVVAAYVMAGFAVLTKGPVGI
VLPGTFLLVFIALRRNTQYIKRLFPPVGIVLFLLVVLSWYGTMYARHGAAFIDSFLGFNN
VVRATVSEHPEMNVWYYYVVLVPVSLLPWTGPCLYGLWKRRGWTDEYVFMTVWAVGTILF
YTAMATKYPTYAYIANMPLLYLGALAVMDLQEKSSCKLWTIVTGPAIFFWLLFLGAALFA
KPGAVVLGDLFWLIVFIPLAMAILVFSQWQKALPAIPIVITAGTMVIYGLLTFQVLTPFY
EYRSSSALIEASSKFPGQIYFFEEYRTSFVYYTDKGAVWTAPASFDENARLKRDAVWSKK
HLFPTEEERSVMDKLQRREALTLIVPRSRYDDYVASPFFPLTRQLGKFGTYTVFTTL

Enzyme Prediction     

No EC number prediction in MGYG000000046_01582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	459	4.8e-86	0.8759259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.45e-41	4	421	7	431	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.18e-25	1	389	2	395	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.62e-13	60	219	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.03e-08	32	193	32	200	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	1.13e-04	46	335	46	382	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL21032.1	0.0	1	537	1	537
AXB83023.1	2.19e-228	1	536	1	536
ALG41393.1	5.23e-228	1	534	1	532
CCC72525.1	7.42e-228	1	534	1	532
AVO73980.1	7.42e-228	1	534	1	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.33e-22	27	337	54	374	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2VBI7	2.04e-23	1	311	1	316	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
A1JPM4	2.75e-23	17	337	20	344	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
A6V1N8	1.16e-21	1	338	1	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
B7LM74	2.78e-21	4	338	5	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=arnT PE=3 SV=2
A8GDR9	2.82e-21	9	341	11	348	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.159438	0.834932	0.002530	0.000950	0.000760	0.001360

TMHMM  Annotations     

start	end
5	27
54	76
81	103
108	130
137	154
169	191
203	225
256	278
287	304
308	325
338	360
364	386
393	415