CAZyme Information: MGYG000000046_01923

Basic Information

• Species: Megasphaera stantonii
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera stantonii
• CAZyme ID: MGYG000000046_01923
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684		78954.11	6.4004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000046	2558124	Isolate	United Kingdom	Europe

• Gene Location: Start: 27040; End: 29094 Strand: +

Full Sequence      

MKLSAIDEYGTFLYHQGTNYASYRLFGAHFTVLRRRSCVRFSVWAPHAQKVSVVGDFNQW
DIEANPMERCGAGNGIWVTYIEGLQEGDIYKYAVTTASGEVLMKSDPYAFWSEVRPNTAS
KITKLRYTWKDKKWQNSREQYDSYRKPMLTYEVHLGSWCRDEEGNMLTYREIADKLVEYV
TSMNYTHIEIMPLCEYPFDGSWGYQATGYFSATSRYGAPEDFMYLVDTCHKHGIGVILDW
VPGHFCRDAHGLRYFDGEPCYESGNPMLAENKEWDTMNFDYGRTEVQSFLISSAMFWLSQ
FHIDGLRIDAVANMLYLDYGHPDGNWQPNKYGGRENLEAIDFLRNLNKAVFSEFPHALMI
AEESSAWPLVTKPVDVGGLGFNYKWNMGWMNDMLRYMSMDPLFRKDNHNLVTFSLCYAFS
ENFILPLSHDEVVHGKHSLLDKMPGDYWQKFAGLRAFYGYWMSHPGKKLLFMGSDFGQFI
EWKYDDSLDWHLLEYPMHKAMHDYVKQLNTYYVEHPEFWEEDCDWSGFSWISCDDRDNSV
IAFFRSGQETDDMTVVVCNFTPVVRHSYRFGVPRKGTYVEVFNSDSEAFGGSNVLNEGEF
EAQDIPMHGMEQSLELTLPPLATIYLQLKTSADKKKSLKAGSSTAKTRKTTGSAKKAKSS
EKKPASKTTRKRAVKKTTKSDAAK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	178	478	1e-155	0.9966777408637874
CBM48	26	110	5e-19	0.868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14705	PRK14705	0.0	3	626	600	1220	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	3	629	100	724	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	25	627	26	620	glycogen branching enzyme; Provisional
TIGR01515	branching_enzym	0.0	12	626	3	617	alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK12313	PRK12313	0.0	13	629	14	628	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL20084.1	0.0	1	684	1	684
AVO27861.1	0.0	1	635	1	635
CCC74190.1	0.0	1	635	1	635
AVO75118.1	0.0	1	635	1	635
ALG42393.1	0.0	1	635	1	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	1.70e-229	12	628	135	773	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	2.41e-229	12	628	135	773	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR0_A	3.41e-229	12	628	135	773	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR5_A	4.83e-229	12	628	135	773	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	6.83e-229	12	628	135	773	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	7.94e-285	1	627	1	626	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q8CZE8	1.29e-248	3	634	4	633	1,4-alpha-glucan branching enzyme GlgB OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=glgB PE=3 SV=1
Q3JCN0	1.09e-247	6	634	111	738	1,4-alpha-glucan branching enzyme GlgB OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=glgB PE=3 SV=1
O66936	2.33e-247	2	627	3	627	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
P16954	2.55e-247	6	628	115	759	1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=glgB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000046_01923.