CAZyme Information: MGYG000000047_01933

Basic Information

• Species: Clostridium disporicum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium disporicum_A
• CAZyme ID: MGYG000000047_01933
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240	MGYG000000047_12|CGC1	28414.47	8.7631

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000047	3448648	Isolate	United Kingdom	Europe

• Gene Location: Start: 53448; End: 54170 Strand: +

Full Sequence      

MNKIPKIIHYCWFGRGEKPDIVRRCIDSWKKNLIGYQIKEWNEDSFDINTNDFVRQAYEN
KKYAFVSDYVRVFALYNYGGIYLDTDVEVIQNFDKYLDNESFWGFEVGNYVATSTIGATK
GNKLIKKFLDSYEGKTFLNEDGSFNVTTNVKIVSKIFEDLGIKLNGEYQRIEGIGAIYPL
EIFSPYDYRYYEDLRNNDTVCIHHYYKSWLPISEKIKQYLKKNIIKIFGSKILKKKERLI

Enzyme Prediction     

No EC number prediction in MGYG000000047_01933.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	22	99	2.2e-24	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.65e-19	3	136	81	218	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.43e-15	19	103	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.69e-14	1	133	43	189	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.002	35	86	142	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWH94883.1	2.15e-104	2	229	5	232
QWI40604.1	3.05e-104	2	229	5	232
QQA15857.1	3.05e-104	2	229	5	232
QWG41839.1	3.05e-104	2	229	5	232
AJH20330.1	3.05e-104	2	229	5	232

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000047_01933.