CAZyme Information: MGYG000000047_02057

Basic Information

• Species: Clostridium disporicum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium disporicum_A
• CAZyme ID: MGYG000000047_02057
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	MGYG000000047_13|CGC3	55317.21	4.8837

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000047	3448648	Isolate	United Kingdom	Europe

• Gene Location: Start: 84725; End: 86179 Strand: -

Full Sequence      

MSNIKFPENFLWGGATAANQFEGGYREGGKGLSTSDVMTGGTHTVARRITPELEEGTYYP
SHEAIDFYHRYKEDIALFAEMGFKTFRMSMNWTRIFPNGDELEPNEEGLKFYDDVFAELK
KYNIEPLVTISHYETPFGLTKKWNAWEDRRTIDCYLRYCETIFNRYKDTVKYWLTFNEIN
ILTHGAAAAFMGAGVMFDDIRELKFGPEAAGHKQECFQALHHQFVASAKAVQLGHSINPD
FKIGCMIAYGKQYPYTCNPEDVLLAQQSEEFSNFLCGDVQVRGAYSGFAKRYFRENNIEI
KMEEGDLETLKNGCVDFYTFSYYMTNCVSKDPNVETTGGNLSMGLKNPYLEASDWGWQID
PVGLRTTLNQIYNRYQIPMMIVENGLGAVDTVEADGSINDDYRINYLKAHIEQMKEAIAD
GVELWGYTPWGCIDLVSAGTGEMKKRYGFIYVDKNNDGTGTLNRSRKKSFYWYKNVIATN
GEEL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	481	2.4e-149	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	5	484	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	6	484	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	484	1	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	5	483	3	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	6	484	6	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY84893.1	0.0	1	484	1	484
QPJ86321.1	0.0	2	484	3	485
QUN34824.1	7.20e-294	1	484	1	486
AQS07528.1	1.45e-293	1	484	1	486
AQR97786.1	2.06e-293	1	484	1	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.06e-210	5	484	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	4.32e-198	1	484	3	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	6.14e-186	5	484	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.75e-185	5	484	6	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.01e-179	5	484	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	7.41e-206	5	484	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46829	2.36e-197	1	484	3	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	1.12e-191	3	484	4	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	1.49e-188	5	484	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P24240	3.58e-188	6	484	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000047_02057.