CAZyme Information: MGYG000000047_02729

Basic Information

• Species: Clostridium disporicum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium disporicum_A
• CAZyme ID: MGYG000000047_02729
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000000047_22|CGC1	36202.69	4.4301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000047	3448648	Isolate	United Kingdom	Europe

• Gene Location: Start: 24211; End: 25158 Strand: +

Full Sequence      

MNEKLIYNGINNYGYKTTKKKVKLYPFIVVIIFTALILFGRNIFFTRTDFDTLGYDKIKY
YIDVTDNVSEGKAQVNWQEVAAINEVLNDGKEDELVSKIAKVFLKNGENGEYTLFTVDEV
LERLKVNNEEEEKVKAFLNEINDNTLYKDLYKDEAKMTFINEIYPAALDNYYNYGILPSI
TMAQAILESGWGESELALEHNNIFGIKADSRWDGAIATMTTKENYDDIIEANFRKYDNIL
QSIADHGEFLNENERYRVNGLFDGKEYKSQAQALENAGYSTAEDENGEKIYADKLINVIQ
KYNLMIFDSKAKSGL

Enzyme Prediction     

No EC number prediction in MGYG000000047_02729.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	164	304	3.9e-35	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	8.49e-49	156	315	43	195	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	1.31e-32	159	301	155	296	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	3.27e-26	159	308	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	5.43e-23	165	304	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	2.10e-20	158	304	10	141	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ75012.1	9.90e-88	7	310	7	317
ATD57589.1	9.90e-88	7	310	7	317
SLK15979.1	9.90e-88	7	310	7	317
ATD54730.1	9.90e-88	7	310	7	317
QSW19705.1	3.34e-82	27	312	37	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	6.46e-16	175	305	22	151	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	8.97e-16	175	305	22	151	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3FI7_A	1.46e-15	156	308	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3VWO_A	2.26e-14	159	299	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.74e-14	159	299	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	7.29e-22	148	308	40	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	7.51e-17	152	305	156	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P75942	4.52e-15	147	301	141	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	4.52e-15	147	301	141	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P15931	4.01e-14	175	305	171	300	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999974	0.000057	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
22	44