CAZyme Information: MGYG000000048_01130

Basic Information

• Species: Clostridium_P ventriculi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P ventriculi
• CAZyme ID: MGYG000000048_01130
• CAZy Family: GT1
• CAZyme Description: Oleandomycin glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000000048_3|CGC5	43954.67	9.4141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000048	2457227	Isolate	United Kingdom	Europe

• Gene Location: Start: 259077; End: 260228 Strand: +

Full Sequence      

MAKILIINVPAHGHVNPTIGLTKALVRAGHDVTYLVSEEFRSKIEPTGAVFESYDFDNKR
PFTEKNVRRVYDRALELGKNADCIVYEMMFFLGKALGDKLNKPTVRLYSCFAWNKEISQQ
VFNNCGFKLKLLGNRAFRKVAFSRRLKSFETKTQDIIDEITDIPADLNIVYTTREFQVDN
DRFDDKIWKFVGPSIVDRNDKNDIPFNEIKNKIIYVSLGTIFNNSLKFFKNCIEAFKNTD
VTVIMSIGKTLKKEQLGKIPNNFYVYNFVPQIEVLKRTDLFITHGGMNSTSEAMYFGVPL
IVVPQAADQPIVGKRIEDLELGRVINKNNISSNIIRNYANEILNDDRYKDNMMKMRTKVR
QAGGEERAVELINDLLKEKLGSD

Enzyme Prediction     

No EC number prediction in MGYG000000048_01130.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	205	376	1.3e-40	0.4109947643979058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	1.86e-116	7	378	1	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
cd03784	GT1_Gtf-like	1.16e-75	2	375	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	1.13e-74	1	379	1	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
PHA03392	egt	6.93e-21	206	360	291	447	ecdysteroid UDP-glucosyltransferase; Provisional
cd03785	GT28_MurG	1.17e-12	191	375	161	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ77785.1	1.77e-123	1	378	1	381
AOZ73988.1	1.77e-123	1	378	1	381
AJA50553.1	1.77e-123	1	378	1	381
ADL53855.1	4.69e-109	1	372	1	361
BAL68673.1	5.32e-101	3	364	8	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	1.55e-67	4	377	6	386	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.77e-67	4	377	6	386	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
2IYA_A	3.02e-44	8	378	19	422	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3RSC_A	3.75e-40	2	376	21	412	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3IAA_A	3.82e-40	2	376	21	412	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora],3IAA_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31853	5.48e-73	1	382	1	402	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
O34539	9.69e-67	4	377	6	386	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q65JC2	3.94e-63	4	376	6	390	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
O05496	5.40e-63	1	379	1	393	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
Q9XC67	2.33e-38	1	376	58	457	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000048_01130.