CAZyme Information: MGYG000000049_00069

Basic Information

• Species: GCA-900066495 sp900066495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; GCA-900066495; GCA-900066495 sp900066495
• CAZyme ID: MGYG000000049_00069
• CAZy Family: GH18
• CAZyme Description: Peroxiredoxin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584	MGYG000000049_1|CGC2	65675.23	4.482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000049	3389401	Isolate	United Kingdom	Europe

• Gene Location: Start: 75495; End: 77249 Strand: +

Full Sequence      

MPCLPSLGSTAPDFEANTTFGPIKLSDYKGKWVVLFSHPGDFTPVCTTEFICFAKYYDEF
QKRNTDLIGLSIDSNSSHLAWVYNICTLTGIEIPFPVIADSNMRIAKLYGMISESMSNTS
TVRSVFIIDDKQVLRTILYYPLTTGRNIPEIIRIIDALQASDNDNIVTPANWLPGMPVIL
PPPKTWKDLKKRINNCGKEYSCLDWYLCFMPGKDVKEIERSQTIPYLNRPPINDPDEQSN
VTNSNCPDLQPIVMEYVLGNPKNVDPNFLDAVIYAFVEINPDGSLLVPTPRYLEYLVSLK
RYNPQLQVIAAIGGWGAEGFSDAASTPKSRYDFARQVNRLINNYNLDGIDIDWEYPGSSA
SGIKSSINDRENFTLLLTAIRDVIGDEKWLSVAGTGDTGYTNRSAEIDKIAPIITYFNLM
SYDFTAGETGERGRRHQANLYDSDLSLPGYSVHGMVQNLIQNGMPSEKILLGVPFYGRLG
ATTTVSNDELRRNYINKNGYQYQFDNEARVPYLIRDGQYAMSIENDLSIYLKGQYVLNNC
LGGIFAWQSTYDQANIYARAMYESINSPIAFADELEDIYGEIPD

Enzyme Prediction     

No EC number prediction in MGYG000000049_00069.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	263	563	9.8e-60	0.8851351351351351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13189	PRK13189	2.35e-120	3	211	7	220	peroxiredoxin; Provisional
cd03016	PRX_1cys	1.94e-115	7	211	1	203	Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.
COG0450	AhpC	1.05e-83	1	192	1	194	Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin) [Defense mechanisms].
PRK13190	PRK13190	6.41e-82	7	209	4	200	putative peroxiredoxin; Provisional
cd06548	GH18_chitinase	2.31e-80	261	552	18	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA08894.1	0.0	1	583	1	582
CEI73471.1	0.0	1	577	1	583
CED94343.1	3.44e-317	1	581	1	587
QYE99248.1	8.30e-307	1	580	1	583
AUN13970.1	9.63e-306	1	580	1	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TSB_AAA	8.77e-183	227	581	13	366	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	1.74e-182	227	581	32	385	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
5OVQ_D	6.42e-85	4	208	6	218	CrystalStructure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_F Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_G Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_H Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_I Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_J Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_L Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5]
5OVQ_A	6.63e-85	4	208	6	218	CrystalStructure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_B Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_C Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_E Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_K Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5]
6Q5V_A	9.89e-65	4	216	6	213	1-CysSiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_B 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_C 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_D 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_E 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_F 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_G 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_H 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_I 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_J 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8R844	6.07e-101	3	209	13	218	Peroxiredoxin 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=TTE2186 PE=3 SV=1
O67024	1.14e-85	4	208	6	218	Peroxiredoxin OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_858 PE=1 SV=1
Q8PYP6	7.02e-67	4	208	1	212	Peroxiredoxin OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=MM_0814 PE=3 SV=1
Q6L140	8.30e-66	7	207	5	198	Peroxiredoxin 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) OX=263820 GN=PTO0727 PE=3 SV=1
Q96XS5	8.45e-66	4	209	6	209	Peroxiredoxin 2 OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=STK_24420 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000049_00069.