CAZyme Information: MGYG000000049_01982

Basic Information

• Species: GCA-900066495 sp900066495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; GCA-900066495; GCA-900066495 sp900066495
• CAZyme ID: MGYG000000049_01982
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000000049_4|CGC9	37194.05	9.6788

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000049	3389401	Isolate	United Kingdom	Europe

• Gene Location: Start: 351008; End: 351970 Strand: +

Full Sequence      

MGKKKIKHLKRRKIRKKKVKKIISIVISLIFIIVLVVGLKYAIEMFKAKNIEDSKIEFYM
DVADEAGKQETQINWKELLAIDMVIYNNDLSKVKKSEVLNRAKKFLNKSKDENGNYTYTL
KSIKEVLNELNFDEKQKSKVEKNLKSLEYLCLGNIKFTENSPEIIFINKIEDIAIKNYNE
YKILPSITISQCILESGWGNSELAKQGNNLFGIKADSSWDGEKISMETSENYDDKIIATF
RVYPSVDQSIKDHGKFLKENPRYEKNGLFEAKHYTTQAQALEDAGYSTKENEYGEKIYAD
MLIKLIRKYNLQLVDSKLYR

Enzyme Prediction     

No EC number prediction in MGYG000000049_01982.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	172	311	2.9e-38	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.60e-48	166	315	46	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	9.32e-29	185	308	174	296	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	3.09e-26	156	313	1	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	4.77e-25	172	253	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
NF038016	sporang_Gsm	1.52e-23	180	311	177	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA07870.1	5.45e-155	1	320	1	320
AXU63721.1	2.52e-103	40	317	43	320
AXU45589.1	2.52e-103	40	317	43	320
AWH80492.1	2.52e-103	40	317	43	320
AWH76725.1	2.52e-103	40	317	43	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	3.73e-12	187	297	27	141	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	4.99e-12	187	297	27	141	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	3.43e-11	189	306	27	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	4.07e-11	189	306	28	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.64e-10	189	306	28	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.10e-21	155	316	36	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	8.96e-18	35	308	51	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	1.71e-15	155	297	153	299	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	6.20e-12	189	297	265	378	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P58231	1.32e-11	187	297	173	287	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998780	0.000867	0.000009	0.000004	0.000002	0.000378

TMHMM  Annotations     

start	end
21	43