CAZyme Information: MGYG000000050_01602

Basic Information

• Species: Blautia_A sp900066505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900066505
• CAZyme ID: MGYG000000050_01602
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519		58982.1	10.0891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000050	3884369	Isolate	United Kingdom	Europe

• Gene Location: Start: 38335; End: 39894 Strand: +

Full Sequence      

MKNWKKWLTCGMFAMALGTAGISGTKDVKAESVNPALLRQNVAEGEEVPQVGASSSSAVD
KRAWRRINGVCYNGSGAEIPGVVTRGIDVSEWQGKINWQKVKNSDIDFAFIRISSGTDYM
DKYYDYNMSSANEADLPVGTYVYSKATTTTAALKEAQLAISKMNGYKVSYPVVYDIEYSK
MESLSKNQIARMTLAFCNEVKAAGYTPMVYMNTHWYKEKVNMSMLSGLDVWIASYSDKNP
APDRSVYNYGIWQCTAGNLGEGSYMRTTKGLVAGIPKENNVDLNYGFVDYTTRVTPRWSA
REGYTPATEASTADISVKNGWYTENGRQCYYINDERVKGWKQINGKYYYFHPVSGNMYVN
SLVKVNGVVYYVDKNGVRTAKRWVTKSRNKYYIGSKGIALKGSQRIKGKYYFFDLDTRIM
YRNKKLVRNGRIFYFGNNGVRFNGGFKTIRENGVYNTYYFQKNGQAKKGWLRLNGKKYYF
YPSGDKAGVCAKHTRIRTASGMIYVFDKNGVYVRRYKRK

Enzyme Prediction     

No EC number prediction in MGYG000000050_01602.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	87	256	3.4e-48	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	8.12e-66	85	287	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
pfam01183	Glyco_hydro_25	3.77e-33	87	255	1	172	Glycosyl hydrolases family 25.
cd00599	GH25_muramidase	1.21e-30	85	285	1	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	2.40e-27	85	285	1	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	2.15e-24	85	285	1	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU01355.1	9.77e-169	1	512	1	505
CBL21600.1	6.84e-71	1	201	1	199
ASM68843.1	1.38e-56	61	334	71	335
CBK77005.1	5.32e-49	63	359	30	303
QQR03194.1	1.09e-41	55	338	71	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	1.81e-15	85	275	21	198	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	8.98e-15	85	275	21	198	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WAG_A	7.98e-14	85	284	17	204	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	3.89e-12	85	256	6	186	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4NBX_A	6.83e-09	320	441	8	138	ChainA, TcdA [Clostridioides difficile]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49331	2.66e-13	319	509	1247	1433	Glucosyltransferase-S OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfD PE=3 SV=3
P26836	1.11e-12	85	284	10	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	1.71e-12	85	249	2	160	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P25310	3.24e-11	77	256	77	263	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
Q8X7H0	4.60e-11	79	253	61	235	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000660	0.994133	0.004526	0.000287	0.000193	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000050_01602.