CAZyme Information: MGYG000000051_00436

Basic Information

• Species: Anaerosacchariphilus sp900066385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerosacchariphilus; Anaerosacchariphilus sp900066385
• CAZyme ID: MGYG000000051_00436
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522		59164.69	6.8613

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000051	3553306	Isolate	United Kingdom	Europe

• Gene Location: Start: 177273; End: 178841 Strand: -

Full Sequence      

MAIAGKIYRALLRFFEKYYGFFFAVGVLVLAFYCFRCLDVKYVDSWDEARHGVNAYEMIQ
NGDYIRHTYNYQVDDWNLKPSISYWAIVLGFRLFGYSVWGLRFFSALAYLLAGVLCALFA
KRWSREASLLVLGFFCANERPLSAHLARAGDADSLYLLFFTVAVLAMFLVKKNHKYVYGC
GLAFSLAFLTKSWHAGMIMAVGGIYLLGTGELRRFRKKEWAGFLLSVFAPLMLWFGWRFT
RDGFFFLKSMIETDLLARTGSSNFEGHQFPFSFYYDTVFGDGGFIYHWQLLICTVGILGG
LLWMWKKKAWNREVLEQGGGLLLWFLLPFLAFSAIGTKLIWYCYPCTVPLALGTAWLLGG
LMRLPLTGEETTQEVDKAAAIGGKKKNFTTVVGITAAAVSVLLVGFYMKNAYFHVIRGAH
GDPFLMFIEESADRDSAWAGGKAYIYVSGEDPADIGTWDQNMLFEAEISGDFHCEEGGIE
AFLSENGRAVLYVDRLDYEQNMEKLQDVEILHENAGYLLLGK

Enzyme Prediction     

No EC number prediction in MGYG000000051_00436.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	27	410	8.8e-53	0.6388888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	7.94e-18	24	367	9	345	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	2.75e-12	79	234	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	1.87e-04	27	135	10	124	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	0.002	27	207	3	197	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	0.004	10	238	10	264	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQT05284.1	3.35e-28	43	345	44	344
AVO74995.1	1.06e-15	24	366	28	372
CCC74317.1	1.06e-15	24	366	28	372
AFY33333.1	1.42e-15	45	364	32	335
ALG42265.1	4.24e-15	24	366	18	362

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	5.98e-14	25	355	10	318	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q4KC80	4.62e-12	24	410	6	368	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1
Q3KCB9	3.30e-11	47	364	31	337	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
Q4K884	2.46e-10	24	404	39	397	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
C5BDQ8	2.06e-08	23	420	8	379	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
98	120
154	171
186	208
220	237
283	305
318	340
388	407