CAZyme Information: MGYG000000051_02449

Basic Information

• Species: Anaerosacchariphilus sp900066385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerosacchariphilus; Anaerosacchariphilus sp900066385
• CAZyme ID: MGYG000000051_02449
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	MGYG000000051_18|CGC1	56158.39	5.9965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000051	3553306	Isolate	United Kingdom	Europe

• Gene Location: Start: 2679; End: 4151 Strand: +

Full Sequence      

MTTLCRQSLLSVKAQKGKKMNALNRTWDKLISQKIKETKDSGSRWRPAFHIAPPVGWLND
PNGLCQYKGIYHAFYQYSPFDEKGGLKFWAHCTSRDMLHWKLEGVPLVPDQPYDCHGVYS
GSAVIEDEHMYLYYTGNVKEAGAYDYINQGRQANTVRAVSYDGIHFERKELLLTNGDYPM
DLTCHVRDPKVWKKNGRWYMVQGARTKEDQGEVLLFTSGDGVKWFCTHRLKSPKAFGYMW
ECPDLYEVDGYTVLSISPQGVEADGFRYNNVYQSVTTFLDSDFRITSVNGSFRELDGGFD
FYAPQTFETEDGRRIEIGWMGMADVDEFYTNRTVEDGWQHVLTLPRELSVKDGVLCQNPI
RELDAYWTKEQPFKNDFAGSLGKAFEIELPDLNKLGENVKITLAEHLWLTWNSREQIFRM
EFQDNLLGSGRTMRGREITRLTDMRVIVDASCVEVFLNGGKDVFSTRFYPEGEEIGVTVN
APGAAGRLRA

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	50	359	8.7e-91	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	2.96e-157	56	352	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	3.67e-148	43	470	11	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.30e-133	27	488	11	477	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	1.94e-109	50	359	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.13e-102	50	460	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO23081.1	1.24e-221	20	489	1	465
QHB24857.1	9.19e-168	20	475	1	454
QEI32364.1	9.19e-168	20	475	1	454
QRT30958.1	1.97e-164	20	475	1	454
QRT48577.1	6.89e-164	20	484	1	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.36e-72	43	474	23	463	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	9.02e-68	24	473	26	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.34e-66	24	473	26	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
3PIG_A	2.96e-59	43	469	37	485	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
6NUM_A	4.99e-58	43	469	37	485	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.99e-105	46	483	29	467	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P16553	7.21e-92	42	473	20	452	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P13394	7.36e-87	47	469	38	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P40714	1.86e-85	42	474	21	454	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P27217	2.97e-84	47	470	28	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000051_02449.