CAZyme Information: MGYG000000052_01921

Basic Information

• Species: Anaerostipes sp000508985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerostipes; Anaerostipes sp000508985
• CAZyme ID: MGYG000000052_01921
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254		29418.96	8.7286

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000052	3273906	Isolate	United Kingdom	Europe

• Gene Location: Start: 22981; End: 23745 Strand: -

Full Sequence      

MFKFTKKNKRELAVICTFLFIVTFIFIWIIQNIGLPIETKVENGHIKVIDVSKYNHKVNW
KKVKDSQINHAVLKIGSGAKKKKKGTEDPMFIANYRNAKISSIHCGVYYYSYAGDVKAAV
KEAKHCISLLKKHDIDPEDLKLPVVFDIEEEEVMKTGKKNVTALTRAFCEEIKRAGYEPM
VYSNAYFLKHYFDYDGIKEYKMWVAHYTKEDEPDIPYQYHMWQFTDQASVPGANTGSGHC
DLNYYLTDKEGNLL

Enzyme Prediction     

No EC number prediction in MGYG000000052_01921.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	49	232	1.4e-45	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	2.75e-78	46	244	1	189	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	6.48e-39	47	245	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	4.25e-30	49	232	1	179	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	5.88e-27	49	245	3	192	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06525	GH25_Lyc-like	7.62e-27	47	245	1	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCD34460.1	7.15e-180	1	254	1	254
QMW72493.1	7.15e-180	1	254	1	254
QCP33809.1	5.69e-161	1	254	1	254
AQP40897.1	3.24e-111	3	250	2	249
CBL39141.1	5.09e-111	3	250	5	252

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	2.30e-15	38	245	260	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	5.69e-15	38	245	260	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	1.27e-08	43	245	6	196	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000007	0.000001	0.000000	0.000000	0.000005

TMHMM  Annotations     

start	end
12	34