CAZyme Information: MGYG000000052_02660

Basic Information

• Species: Anaerostipes sp000508985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerostipes; Anaerostipes sp000508985
• CAZyme ID: MGYG000000052_02660
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000000052_23|CGC1	53930.21	5.1537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000052	3273906	Isolate	United Kingdom	Europe

• Gene Location: Start: 27027; End: 28430 Strand: -

Full Sequence      

MSFQKDFLWGGALAANQCEGAYLEDGKGLSIQDVMPKGVAGSVSEQPVPENLKLIGIDFY
HRYEEDIRLMAEMGFKVFRMSIAWSRIFPKGDEEQPNEKGLEFYDRVFDTCRLYGIEPMV
TLSHYETPLYLAKTYDGWRSRQMITFFDRYCRTVFERYQDKVKYWMTFNEINALWHFPLM
GAGIWTPKEQLTEQDKYQAAHHEFVASALAVKRLHDMIPDAKMGCMVLGALSYPMTPKPD
DMIAMMEADRKVMFFSDVQTRGYYPSYIKKYWEKNGICIQMESGDEELLKNTVDYVSFSY
YMSKCTAADCSLYSKGAGNLTSGVKNPYLPESEWGWQIDPQGLRYTLNYFYDRYQKPLFI
AENGLGANDQLVDDGQGGYTVRDDYRIEYLRNHLKEVEKALDDGVDVMGYAAWGCIDVVS
ASTAQMKKRYGFVYVDRNEDGSGSLTRYKKKSFYWYRDVISSNGASL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	464	1.1e-151	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15014	PRK15014	0.0	1	467	4	477	6-phospho-beta-glucosidase BglA; Provisional
PRK09589	celA	0.0	1	467	2	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	1	464	2	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	467	4	477	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	2	467	3	473	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94299.1	1.36e-283	1	467	1	467
AJG99217.1	1.39e-248	1	467	3	469
AQS05581.1	1.39e-248	1	467	3	469
AIU02364.1	3.26e-247	1	467	3	469
ABR34980.1	3.26e-247	1	467	3	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IPL_A	6.70e-219	3	467	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
6WGD_A	1.71e-212	3	467	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	3.98e-172	1	467	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	5.80e-162	5	467	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.65e-161	5	467	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	3.12e-237	1	467	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	6.58e-212	3	467	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	1.05e-197	2	467	3	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	2.74e-193	3	467	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P11988	8.76e-191	2	467	3	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000052_02660.