CAZyme Information: MGYG000000052_03281

Basic Information

• Species: Anaerostipes sp000508985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerostipes; Anaerostipes sp000508985
• CAZyme ID: MGYG000000052_03281
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
177	MGYG000000052_51|CGC1	19196.05	8.8627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000052	3273906	Isolate	United Kingdom	Europe

• Gene Location: Start: 6190; End: 6723 Strand: -

Full Sequence      

MKLIKSILTKNPCYTAGKKITVKGLMLHSVGCPQPRASVFINSWNRADYGNACVHAFIDG
MDGTVYQTLPWNHRGWHCASGKNGSGNNTHIGVEMCEPACIKYTGGSTFTCSDKAAAKAV
VKRTYEAAVELFAMLCKEYGLNPTADGVIISHKEGHKRGIASNHGDPEHLWKQLGMG

Enzyme Prediction     

No EC number prediction in MGYG000000052_03281.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06583	PGRP	8.65e-23	22	167	2	123	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
pfam01510	Amidase_2	1.45e-17	21	167	1	119	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
smart00644	Ami_2	1.65e-15	21	154	2	119	Ami_2 domain.
COG5632	CwlA	7.23e-10	2	153	7	141	N-acetylmuramoyl-L-alanine amidase CwlA [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ98955.1	2.95e-113	1	177	1	177
AFC63685.1	3.66e-113	1	177	1	177
QJU15163.1	4.25e-104	1	177	1	177
AMP42248.1	2.86e-102	1	177	1	177
ADL53623.1	1.59e-101	1	177	1	173

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HMB_A	4.34e-07	34	99	25	101	ChainA, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis],3HMB_B Chain B, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis],3HMB_C Chain C, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis]
3RDR_A	8.28e-07	42	99	33	101	Structureof the catalytic domain of XlyA [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24808	2.34e-06	28	122	15	117	N-acetylmuramoyl-L-alanine amidase CwlA OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlA PE=1 SV=1
P54450	2.91e-06	62	99	62	99	N-acetylmuramoyl-L-alanine amidase CwlH OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000052_03281.