CAZyme Information: MGYG000000053_00227

Basic Information

• Species: Alistipes sp002358415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp002358415
• CAZyme ID: MGYG000000053_00227
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	MGYG000000053_1|CGC2	63422.69	6.8707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000053	2181722	Isolate	United Kingdom	Europe

• Gene Location: Start: 258637; End: 260346 Strand: +

Full Sequence      

MMKRLSLACLLAGLALHAGAQVPASLDEVWAPVRVGTPPSDAYIGLSLLEDGEIRHYNYG
EQAEAGTFYLSSRDGGLTWRKVSCARGMLYADRRSPLSGEYVRLANMGPMGVYCIRTEGG
IGGDRTLTRVTDTPSIMIKPPVFVRGGRRIVVAAHGGVAPKGCYTYVSDDDGRTWRRSNV
VTSPDHRGGGFHRGIRWNHGAVEPTLVELADGRLWMLMRTSQDRHYEAFSDDGGLTWGEA
QPSRFYGTITMPTLGRLADGRLLLFWCNTTPLPELETADGVWDDVFTNRDATHVAISEDE
GRTWTGFRELHLDPLRNASDYALRGGGIDRGMHQAQFVEVAPGKVLASIGQHPLHRALVL
FDVGWLYEKERFDDFSDSLAGWSAFNYLRGIKGHCSYNRVEGCRVEPHPEKAGRQVLHLR
YEADERLVEDARGAVWNFPAMRRGRFATSLRIPEGCRGVSLLLNDRWFNPSDTVACHEAI
YALRLDRRELGIGDDGWHEVALEWDLDAQDAPEARVRVDGRLRRVRLPQLNACRDGISYV
HFIARPVAPLSDGRCPGICVERVVAEARD

Enzyme Prediction     

No EC number prediction in MGYG000000053_00227.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	62	308	2.5e-22	0.5409356725146199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	4.47e-24	53	314	32	303	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	7.65e-16	140	320	115	262	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	8.18e-08	168	349	52	216	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	0.002	205	332	26	151	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	0.002	226	319	21	109	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ47658.1	3.03e-314	2	567	1	563
QLK85135.1	3.03e-314	2	567	1	563
AUI49199.1	3.03e-314	2	567	1	563
QCQ52211.1	4.30e-314	2	567	1	563
QRM72816.1	4.30e-314	2	567	1	563

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000338	0.998901	0.000201	0.000191	0.000179	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000053_00227.