CAZyme Information: MGYG000000053_01762

Basic Information

• Species: Alistipes sp002358415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp002358415
• CAZyme ID: MGYG000000053_01762
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445		49939.41	6.1967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000053	2181722	Isolate	United Kingdom	Europe

• Gene Location: Start: 26412; End: 27749 Strand: -

Full Sequence      

MMRSLSLAARRDADGVFTFPAPDRPAGQRSVLGLRTEPIECLRVGFVGLGLRGPTAVERF
THIEGVRIAALCDVDPERVEAAQRILADRNLPAAAAYTGAEGWRRLCERDDVDLVYVCTP
WDSHTPIALYAMEQGRHVAVEVPAATSLAECWALVDTAERTQRHCMMLENCIYDLFALTT
LRMAQEGVLGDLLHVEGAYIHPFDTWERWRLEFNRRRRGDLYATHGLGPACQLLDIHRGD
RLDYLVAVDTPAVGGSAAAGRQTGDPSFANGDQTSTLLRTVRGRTVSLQHNVATPRPYSR
RYQVVGSEGFAEKYPAEEYAFSARRIAELFPDGAECRPNEYLPEALRRTLAERFRHPIAA
QVGEERARRIDPVREGINFRMDYRLVYCLRHGLPLDQDVYDAAEWSSMGELTALSLAHRS
APVAVPDFTRGEWERIDGYRHAYAE

Enzyme Prediction     

No EC number prediction in MGYG000000053_01762.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	38	434	4.3e-143	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.23e-29	42	338	4	284	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	9.96e-17	42	167	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.52e-09	40	235	3	183	putative oxidoreductase; Provisional
PRK10206	PRK10206	2.66e-07	111	196	64	149	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77663.1	1.81e-206	14	445	31	465
BBL11909.1	2.51e-204	14	445	31	466
BBL01207.1	2.51e-204	14	445	31	466
BBL09117.1	2.51e-204	14	445	31	466
BBL06379.1	6.78e-202	14	442	30	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.68e-79	20	434	21	439	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	8.16e-53	42	434	21	432	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
5A02_A	9.07e-17	37	344	2	288	Crystalstructure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A03_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A04_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A05_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A06_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15]
4H3V_A	8.57e-14	85	309	42	287	ChainA, Oxidoreductase domain protein [Kribbella flavida DSM 17836],4H3V_B Chain B, Oxidoreductase domain protein [Kribbella flavida DSM 17836]
1OFG_A	1.97e-12	22	234	11	226	ChainA, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_B Chain B, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_C Chain C, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_D Chain D, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_E Chain E, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_F Chain F, Glucose-fructose Oxidoreductase [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C863	1.71e-183	20	445	32	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	1.71e-183	20	445	32	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
Q7MWF4	1.76e-174	22	445	38	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
A6KX96	2.77e-174	20	445	39	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q89ZX8	5.58e-173	22	445	37	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000053_01762.