CAZyme Information: MGYG000000053_01802

Basic Information

• Species: Alistipes sp002358415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp002358415
• CAZyme ID: MGYG000000053_01802
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228	MGYG000000053_16|CGC1	25567.1	8.245

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000053	2181722	Isolate	United Kingdom	Europe

• Gene Location: Start: 4549; End: 5235 Strand: +

Full Sequence      

MLKKTVLTFAFLSILTTFYGFNARFAASTFAVDGEIAGAALPGPDDATVISTYDEIFRAI
SEREGHDWRLMSAIAYHESRFTPDLTSRRGAQGMMQIMPSVARQFDVPAERICDLETNIW
LANKLFSEIQRSLRLPASVPERDRMSIVLASYNGGIGHVSDARRLARVNGENPDSWEVVA
RYLRLKADPAYYGHEVVRCGRFTGSSQTLAYVDDVMGRYGKYCRMASR

Enzyme Prediction     

No EC number prediction in MGYG000000053_01802.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	63	222	3.9e-20	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	3.03e-60	57	224	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	5.09e-28	67	192	283	404	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	2.11e-27	48	219	285	446	membrane-bound lytic murein transglycosylase MltF.
cd13401	Slt70-like	1.05e-17	53	176	6	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	2.24e-17	57	167	1	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK65133.1	6.73e-113	1	228	1	230
BBL08197.1	3.41e-111	1	228	1	232
BBL10988.1	3.41e-111	1	228	1	232
BBL00117.1	3.41e-111	1	228	1	232
AFL78639.1	3.70e-110	1	228	1	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA4_B	2.81e-18	53	219	252	411	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	2.81e-18	53	219	252	411	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA2_B	3.14e-18	53	219	300	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_A	3.14e-18	53	219	300	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_D	3.14e-18	53	219	300	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0VRG6	1.05e-21	53	219	288	447	Membrane-bound lytic murein transglycosylase F OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=mltF PE=3 SV=1
A1U3J1	2.25e-21	53	197	286	435	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
A3QCH2	3.83e-21	67	219	292	437	Membrane-bound lytic murein transglycosylase F OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=mltF PE=3 SV=1
A8H256	4.67e-20	64	219	289	437	Membrane-bound lytic murein transglycosylase F OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=mltF PE=3 SV=1
Q0AQY9	5.85e-20	53	198	289	439	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.121183	0.854239	0.023164	0.000591	0.000388	0.000418

TMHMM  Annotations     

start	end
5	27