CAZyme Information: MGYG000000054_00479

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_00479
• CAZy Family: GH28
• CAZyme Description: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		37863.42	6.5769

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 36434; End: 37441 Strand: -

Full Sequence      

MKGRLLIVIFISICFIAGSCNVSSVQGSRYNFSLLDSVIQGWVSKEYYPGASISEIVKGH
PLVVKQGRVEVGNGSLYYEEAGRGEPVIFVHGHSLDHRMWDEQFPVFAKKYRVIRYDLRG
YGISSSQTEDYQFTHAEDLVTLMDSLHIKKAHIVGLSLGGFITADMLAYFPDRMLSAFLA
SGNIRKSKGPSEPMTPEEARVRDKEIAALKEKGVDVMKKEWFEGLMKSGGSQRERMRESL
WQMIDEWDAWQPLHKEVRVVAGLDAIEELKKNHPDVPALIVEGHSSGNRFSKEPPILQYL
PNGKLKVIDDCGHMLNMERPEEFNAALEEFLKSVQ

Enzyme Prediction     

No EC number prediction in MGYG000000054_00479.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0596	MhpC	1.95e-37	69	334	5	282	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].
TIGR02427	protocat_pcaD	5.59e-30	76	332	2	251	3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other]
pfam00561	Abhydrolase_1	2.72e-22	86	320	2	245	alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.
PRK14875	PRK14875	3.54e-19	68	334	113	371	acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional
pfam12697	Abhydrolase_6	1.68e-15	87	326	1	212	Alpha/beta hydrolase family. This family contains alpha/beta hydrolase enzymes of diverse specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT92203.1	8.54e-156	57	332	511	786
ALJ62047.1	1.71e-155	57	332	511	786
QIX26164.1	7.47e-08	65	330	13	291
AUC52959.1	5.36e-06	75	174	18	122

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EGN_A	1.01e-20	69	331	4	260	Est816as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_B Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_C Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_D Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_E Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_F Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_G Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_H Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium]
3FOB_A	1.52e-19	76	332	19	280	Crystalstructure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames],3FOB_B Crystal structure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames],3FOB_C Crystal structure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames]
1HKH_A	2.06e-16	67	181	1	124	unligatedgamma lactamase from an Aureobacterium species [Microbacterium],1HKH_B unligated gamma lactamase from an Aureobacterium species [Microbacterium],1HL7_A Gamma lactamase from an Aureobacterium species in complex with 3a,4,7,7a-tetrahydro-benzo [1,3] dioxol-2-one [Microbacterium sp.],1HL7_B Gamma lactamase from an Aureobacterium species in complex with 3a,4,7,7a-tetrahydro-benzo [1,3] dioxol-2-one [Microbacterium sp.]
1A7U_A	1.30e-15	76	331	15	275	ChloroperoxidaseT [Kitasatospora aureofaciens],1A7U_B Chloroperoxidase T [Kitasatospora aureofaciens],1A8U_A Chloroperoxidase TBENZOATE COMPLEX [Kitasatospora aureofaciens],1A8U_B Chloroperoxidase TBENZOATE COMPLEX [Kitasatospora aureofaciens]
1BRO_A	1.30e-15	76	331	15	275	BromoperoxidaseA2 [Kitasatospora aureofaciens],1BRO_B Bromoperoxidase A2 [Kitasatospora aureofaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q55921	4.72e-17	76	332	16	276	Putative non-heme chloroperoxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr0314 PE=3 SV=1
O31168	7.19e-15	76	331	16	276	Non-heme chloroperoxidase OS=Kitasatospora aureofaciens OX=1894 GN=cpo PE=1 SV=1
P29715	7.19e-15	76	331	16	276	Non-haem bromoperoxidase BPO-A2 OS=Kitasatospora aureofaciens OX=1894 GN=bpoA2 PE=1 SV=3
P33912	9.43e-15	76	331	12	273	Non-heme chloroperoxidase CPO-A1 OS=Kitasatospora aureofaciens OX=1894 GN=bpoA1 PE=1 SV=3
Q6F9F4	2.79e-14	73	333	11	261	(E)-2-((N-methylformamido)methylene)succinate hydrolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=tgnD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000017	0.012693	0.987306	0.000004	0.000006	0.000005

TMHMM  Annotations     

start	end
5	27