CAZyme Information: MGYG000000054_00730

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_00730
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
909		105295.94	8.2473

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 15026; End: 17755 Strand: +

Full Sequence      

MKNKFIKLVFVAFALITQLSPLKAQTQEIDLSGKWGFQTDVMDFRRGSLDVRYIHRLQES
IVLPAITDDYKIGYKSPYRHIDRLTRVYEYMGPAWYQREIAIPKEWKGKRIFMYFERTHW
LSSIYVDTKEVSKIDYVSVPHNHELTDFVKPGKTHVITVCIDNRYQYDTHKWDHAHSEFT
QINWNGILGEMKLMAVDPVYIDDMQLYPDVSDRSVKVKMKILNHTHKPVTGKAAFTISGN
SYDLNKEITVSGNDSVFYVEDVIALGKNVRLWDEFTPNLYTLQCDLTIRADNANYQHSRS
TTFGMREITADKDKIYLNGNRIHLRGTVENAVFPKTGYAPVDDASWERVLTILKDYGMNH
MRFHSWCPPAAAFRVADKLGVYLEVEMPMWGKDAEPDEARYNFFRREQKAILKEYGNHPS
FVLYCNGNEITGNFDFIEELTHYGRTTDSRRLYSGSTARTRVKSGQFYITHQTTKGHMAI
YEGRPSTDWDKNKELGIDVPVISHESGQRCIYPNFKEIPNFTGPVQARNFEVYRDSLEAH
GMLDQADDFYQVSGAQTVLEYKDVIEAQLRTYLKSGFQLLSINDFTGQGYAPVGILDPFW
NSKGLITPEKFREFCAPTVALLRFSKRSYYNDDVFTGKAEIYNYSPSALKNAKFKWWVTD
ADGKVLKSGKLKTQNIGNHGVFSAGEFSYALNGITAPQKLTVHLSVNNTINNSWDIWVYP
RRELKELMQSTADVLYTTVFDDRAKQFLKEGRKVVLCPMPAKVIGRSSNFHNHFWNPIMF
KWKPMTLGCLIHTDKAMFDDFITEKHLDWQWWDILTHAKVIEMDEAPRQLRPFIQVIDSY
ETNHKLGIGFEARIGNGKLMVLALDTKKEMEKRPATQQLLVSIDRYVKSDRFNPQVDVEA
SFIESFLRK

Enzyme Prediction     

No EC number prediction in MGYG000000054_00730.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	23	680	1e-68	0.6888297872340425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	1.24e-20	19	326	2	296	beta-D-glucuronidase; Provisional
COG3250	LacZ	3.43e-20	26	430	10	407	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	7.87e-13	199	306	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	2.35e-10	96	477	113	508	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	3.20e-06	31	187	4	159	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU06734.1	0.0	1	909	1	907
QQT78472.1	0.0	1	909	1	907
ASM65010.1	0.0	1	909	1	907
QRP59643.1	0.0	1	909	1	907
QUT64934.1	0.0	10	909	8	906

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GM8_A	4.46e-21	92	432	66	399	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6U7J_A	1.11e-20	19	456	11	448	UnculturedClostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_B Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_C Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_D Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.]
6HPD_A	2.35e-16	50	505	56	509	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
5T98_A	8.18e-16	92	435	84	423	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
3CMG_A	1.07e-14	27	451	5	421	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	1.91e-20	94	456	105	475	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P26257	2.80e-17	29	455	5	415	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
T2KN75	1.28e-15	50	505	47	500	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
Q5R5N6	9.93e-14	19	538	28	574	Beta-glucuronidase OS=Pongo abelii OX=9601 GN=GUSB PE=2 SV=2
O77695	1.72e-13	19	571	25	596	Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops OX=9534 GN=GUSB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000340	0.998603	0.000443	0.000198	0.000203	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000054_00730.