CAZyme Information: MGYG000000054_00748

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_00748
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817		90831.19	6.8892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 46257; End: 48710 Strand: +

Full Sequence      

MKKKTGIIGLCMLACSILTHAQTITPQVEQRAKEIVSKMTLQEKIEYISGYTSFSLRAIP
RLGIPEIRLADGPQGIRNHAPKSTLYPSGILSASTWNRDLLYKLGQGLGQDAKARGVSIL
LGPGVNIYRAPLCGRNFEYFGEDPYLTGETAKQYILGVQSEGVIATIKHFAGNNQEWSRH
HASSDIDERTLHEIYFPAFRKAVQEANVSAVMNSYNLLNGVHATEHKWLNIDVLRNLWGF
KGILMSDWTSVYSAIGAANAGLDLEMPKGRFMNADNLIPAIKTGTVTEETINLKVQHILQ
TLIAYGMLDKEQKDSNIPLDNPFSRQTALELAREGVVLLKNEANLLPLKGKTAVMGPNAD
LIPTGGGSGFVTPFSTVSVAQGLKELKKKNLVLLTDDVIYEDIVNEFYTDANRQVKGFKA
EYFKNKTLSGQPEVVRTESSVDYDWGYGAPLDGFPTDGFSVRWTACYVPQADGQLKLHIG
GDDGYRLFVNDKHITGDWGNHSYSSREVELPVEGGKEYRFRIEFFDNISSAIIRFNAYSL
NEAKLRQGLAKVDNVVFCTGFNSNTEGEGFDRPFALLRYQELFIKKIAAMHPNVVVVLNA
GGGVDFTNWYDAAKAILMAWYPGQEGGRAIAEILTGKISPSGKLPISIEKTWEDNPVHGS
YYENLKAEIKRVDYSEGVFVGYRGYDRSGKAPFYPFGYGLSYTTFAYSNMAAEKTGEHQV
TVSFDIENTGKMDASEVAQVYVHDVHSSVPRPQKELKGYEKVFLKKGEKKRVSVVLDEDA
FSFYDMNQHRFVVEKGEFEILAGPASNRLPLKVTVGW

Enzyme Prediction     

No EC number prediction in MGYG000000054_00748.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	58	267	4e-68	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.88e-81	1	808	1	756	beta-glucosidase BglX.
COG1472	BglX	4.54e-79	57	391	53	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.00e-54	10	777	12	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.22e-47	61	299	63	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.10e-42	336	682	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93207.1	0.0	1	815	1	815
QUT26117.1	0.0	1	815	1	815
ALJ47550.1	0.0	1	815	1	815
QRQ54466.1	0.0	1	815	1	815
CBK67093.1	0.0	1	815	1	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.60e-136	33	815	6	666	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	1.04e-125	33	807	7	826	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.73e-122	33	807	7	826	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
5WAB_A	7.12e-115	36	806	9	652	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	9.58e-114	30	814	2	710	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27034	1.17e-146	34	815	4	808	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
P14002	1.42e-135	33	815	6	666	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
Q5BFG8	8.68e-134	33	816	12	837	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
A1DNN8	5.86e-132	25	802	6	840	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
B0Y8M8	1.77e-130	30	815	11	856	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002200	0.725066	0.270667	0.000788	0.000696	0.000543

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000054_00748.