CAZyme Information: MGYG000000054_01452

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_01452
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000000054_12|CGC2	88920.6	5.5797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 89022; End: 91370 Strand: -

Full Sequence      

MKKPLLYLLILLVTVFSTSCSQSSKETFEIGDKTFLLNGKPFVVKAAEIHYPRIPKEYWE
HRIKMCKALGMNTICLYVFWNFHEPEEGKYDFTGQKDIAAFCRLAQENGMYVIVRPGPYV
CAEWEMGGLPWWLLKKKDIKLREQDPYYMERVKLFMNEVGKQLTDLQISKGGNIIMVQVE
NEYGSFGIDKPYIAEIRDIVKQAGFTGVPLFQCDWNSNFENNALDDLLWTINFGTGANID
DQFKRLQELRPDIPLMCSEFWSGWFDHWGAKHETRSAEDLVKGMKEMLDRNISFSLYMTH
GGTSFGHWGGANFPNFSPTCTSYDYDAPINESGKVTPKYFEVRNLLSNYLPEGESLPEVP
DSIPTIAIPSFKLNEVAILFDNLPEPKISENIQSMEAFDQGWGSILYRTTLPASKEEQTL
TITEAHDWAQVFLDGKKLATLSRLKGEGTVILPPMKEGAQLDILVEAMGRMNFGKGIYDW
KGITEKVEVQSNNGVITSLKNWKVYNIPVDYAFAQNKEFMKQDNPLKYPAYYRGTLMLDK
TGDTFLDMTNWSKGMVWVNGYAIGRYWEIGPQQTLYVPGCWLKKGENEVIILDMAGPVQP
ETAGLQQPILDNLRVHGAAYAHRKVGENLDLSGETPVYKGAFKAGNGWQHVKFGKEVETR
FFCLEALNAHDGKDFAAIAELELLGADGKPLSRQHWKVVYADSEETEEANNIATNVFDLQ
ESTFWHTSYSSAAKHKFPHQIVINLGEDKVVTGFSYLPRAEAGKTGMIKDYRVYLKMTPF
KI

Enzyme Prediction     

No EC number prediction in MGYG000000054_01452.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	35	346	8.9e-123	0.990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	2.12e-174	34	347	1	316	Glycosyl hydrolases family 35.
PLN03059	PLN03059	7.88e-55	16	596	18	715	beta-galactosidase; Provisional
COG1874	GanA	3.09e-49	33	656	6	637	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.09e-12	51	184	3	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam00754	F5_F8_type_C	1.68e-06	701	774	2	69	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT69620.1	0.0	1	782	1	782
QUT43141.1	0.0	1	782	1	779
QUT70581.1	0.0	1	782	1	779
BCA49603.1	0.0	1	782	1	779
QMW87348.1	0.0	1	782	1	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	0.0	1	782	1	779	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	0.0	24	627	4	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	3.54e-156	32	594	21	578	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	5.02e-127	28	614	4	591	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
3WF3_A	4.18e-121	18	594	23	622	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	3.23e-129	17	577	19	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
P23780	7.40e-120	35	594	42	623	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
P16278	8.66e-120	8	594	12	621	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q9TRY9	2.63e-119	23	594	28	622	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q95LV1	4.93e-119	2	612	4	626	Beta-galactosidase-1-like protein OS=Macaca fascicularis OX=9541 GN=GLB1L PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000095	0.999967	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000054_01452.