CAZyme Information: MGYG000000054_01541

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_01541
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
946		104794.94	5.913

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 29711; End: 32551 Strand: +

Full Sequence      

MKKLLLTGLFLGSCALLPAQKTTRIPAIYKPVRTEMYKKGWIDFNKNGVKDTYEDPAAPI
DARIEDLLSQMTLEEKTCQMVTLYGYKRVLKDDLPTPEWKNQLWKDGIGAIDEHLNGFQQ
WGLPPSDNEYVWPASKHAWALNEVQRFFIEETRLGIPTDFTNEGIRGVESYKATNFPTQL
GLGHTWNRQLINQVGLITGREARMLGYTNVYAPILDVGRDQRWGRYEEVYGESPYLVAEL
GIEMVKGMQHNHQVAATGKHFIAYSNNKGAREGMARVDPQMSPREVEMLHAYPFKRVIRE
AGLLGVMSSYNDYDGFPIQSSYYWLTTRLRGEMGFRGYVVSDSDAVEYLYTKHGTAKDMK
EAVRQSVEAGLNVRCTFRSPDSYVLPLRELVKEGGLSEEVINDRVRDILRVKFLVGLFDN
PYQTDLKGADKEVEKKENEEVALQASRESIVLLKNDKNVLPLDASSIRKIAVCGPNADER
SYALTHYGPLAVEVTSVLKGIQEKMKGKADVLYTKGCDLVDANWPESELIDYPLTDEEQK
EIDKAVSQAKQADVAVVVLGGGQRTCGENKSRSSLDLPGRQLDLLKAVVATGKPVVLVLI
NGRPLSINWADKFVPAILEAWYPGSKGGIAVADVLFGDYNPGGKLTVTFPKTVGQIPFNF
PCKPSSQIDGGKNPGADGNMSRANGALYPFGYGLSYTTFEYSDLRISPAVITPNQKTYVS
CKVTNTGKRAGDEVIQLYVRDVLSSVTTYEKNLAGFERVHLKPGETKEITFPVDRKALEL
LNADMHWVVEPGDFTFMLGASSTDIRLNGTLTVVEPGQTPAANTTKDSSPVSASTNAETA
DNVIDNNLTTSWEGNKGDYITFALQNGAKIDGVSIAFSRENGLETDFEIQLSSGGGQFLT
VYSGTVKEHNKLLDFRFKGTTASDLRIVLGSDRVGVAEVKLPQLKK

Enzyme Prediction     

No EC number prediction in MGYG000000054_01541.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	150	375	6e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	61	806	35	758	beta-glucosidase BglX.
PLN03080	PLN03080	8.79e-94	59	799	48	769	Probable beta-xylosidase; Provisional
COG1472	BglX	9.70e-78	137	519	41	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	4.12e-69	450	696	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.77e-61	72	411	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94792.1	0.0	1	946	1	946
QQT77476.1	0.0	1	946	1	946
QRP57280.1	0.0	1	946	1	946
ASM65968.1	0.0	1	946	1	946
QUU08154.1	0.0	1	946	1	946

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	3.92e-132	141	806	69	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.12e-131	141	806	69	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	4.79e-125	50	813	4	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5TF0_A	1.78e-124	141	806	68	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
7EAP_A	3.61e-124	50	813	4	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	9.64e-143	153	802	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	2.67e-135	61	806	35	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	5.61e-134	61	806	35	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	8.79e-122	53	806	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.77e-99	55	805	32	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000081	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000054_01541.