CAZyme Information: MGYG000000054_03285

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_03285
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
881	MGYG000000054_52|CGC1	101317.14	6.1714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 10702; End: 13347 Strand: -

Full Sequence      

MINLTGKKAQIACGLLCCCSMVYAQSNDNSEVLTLHTDWEFSQVGTEVWRTAVVPGTVHQ
DLIHHNLIPSPFYGTNEQKIQWIENEDWEYKTAFTITADQLKRDDAQLTFEGLDTYADVY
LNGALLLKADNMFVGYTIPVKKYLRSGENLLHIYFHSPIRQTLPQYASNGFNYPADNDHH
EKHLSVFSRKAPYSYGWDWGIRMVTSGVWRPVTIRFYDAASISDYHVKQLSLTDQVAKLS
NELEINNILPHPLQAEIKINTSLEGEQESAMSQTVILQPGINHVCIPTEVVSPVRWMPNG
WGAPTLYDFSAQIITEGNIVAEQSHRIGLRTVRLVNEKDADGESFYFEVNGIPMFAKGAN
YIPQDALLTNVTTERYQTLFRDIKEANMNIVRVWGGGTYEDDRFYNLADENGILVWQDFM
FACTPYPSDPTFLKRVEAEACYNIRRLRNHPSLAMWCGNNEILEALKYWGYQKKYTPEIY
REMMTGYDKLFRELLPAKVKELDADRFYIHSSPYLANWGRPESWGIGDSHNWGVWYGKKP
FESLDTDLPRFMSEFGFQSFPEMKTIATFASPEDYEIESEVMNAHQKSSIGNDLIRTYME
RDYIVPEKFEDFVYVGLVLQGQGIRHGLEAHRRNRPYCMGTLYWQLNDSWPVVSWSGIDY
YGNWKALHYQAKRAFAPIHINPIRQNDSLCVYLLSDRPDTMEKMTLEMKITDFEGKKSGK
TIQLKSLSIPANTSQCVYKAKPDDLLSLIERKSSETSQSSAEKRLSEVFRHCFMQLTLKD
KSGHTVAETVYFFEKTKDLLLPETNITCKMKQTDGKCELTLLSPALAKDVFIEIPLQGAR
FSDNFFDLLPGERKTVVITSPQIKKGKELPLKLKHIRETYN

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	22	815	2.9e-110	0.7872340425531915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.68e-107	30	868	10	794	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	4.74e-17	803	874	1	72	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	1.96e-13	687	798	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	2.01e-13	220	330	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02836	Glyco_hydro_2_C	1.93e-04	347	461	8	135	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95643.1	0.0	1	881	2	882
ANU57323.1	0.0	1	881	2	882
QQR17806.1	0.0	1	881	2	882
QUU08751.1	0.0	1	881	2	870
QQT76953.1	0.0	1	881	2	870

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	0.0	25	880	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	0.0	25	880	3	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	0.0	25	880	1	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	0.0	25	880	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]
2JE8_A	0.0	25	880	3	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	1.72e-127	34	876	8	841	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q2TXB7	1.06e-124	35	876	9	842	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	2.91e-124	35	876	9	842	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q4WAH4	1.20e-122	35	876	9	843	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	4.62e-122	35	876	9	843	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005259	0.534190	0.457743	0.001424	0.000784	0.000576

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000054_03285.