CAZyme Information: MGYG000000054_03670

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_03670
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		45702.76	6.2442

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 3988; End: 5193 Strand: +

Full Sequence      

MNRNLLKLIVACGAACFIACTPPQKAETEKWSERMARSEMKRFPEPWMIEKAKKPRWGYT
HGLVVKSMLEEWKHTGDSTYYDYAKIYADSLIDADGHIRTMKYLSFNIDNVNGGKILFDL
YAQTGDERYKIAMDTLCKQMAEQPRTSEGGFWHKLKYPHQMWLDGIFMASPYLAQYGATF
HESGLFDEAVKQILLINRKTYDHATGLYYHGWDESRDQKWANPETGCSPNFWSRSIGWYG
AAIVDVLDYLPQDIAGRDSVMQILQGLAKTLVKYQDSQSGTWHQVTDQGAREGNYLESSA
TALFIYTLAKAINKGYIGKEYIESTQKAFEGIVKTFTRLEEDGSYTITNCCAVAGLGGDS
KRYRDGSFEYYISEPVIENDPKSVGSFILAAIEYEKMIDKQ

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	396	5.3e-122	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.54e-142	31	397	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.52e-111	21	396	7	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95830.1	1.60e-291	1	401	1	401
QMW88032.1	7.53e-283	1	400	1	400
QUT38413.1	7.53e-283	1	400	1	400
ALJ42168.1	7.53e-283	1	400	1	400
QQA06610.1	7.53e-283	1	400	1	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.83e-103	57	397	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	9.13e-96	56	397	38	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.78e-95	56	397	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	5.03e-27	57	334	65	330	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.29e-23	57	364	66	356	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.00e-95	56	397	38	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.18e-46	168	393	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.18e-46	168	393	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000043	0.999991	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000054_03670.