CAZyme Information: MGYG000000055_00093

Basic Information

• Species: Muribaculum intestinale
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum intestinale
• CAZyme ID: MGYG000000055_00093
• CAZy Family: GH16
• CAZyme Description: Keratan-sulfate endo-1,4-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270	MGYG000000055_1|CGC2	31129.02	4.4197

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000055	3235245	Isolate	United Kingdom	Europe

• Gene Location: Start: 122265; End: 123077 Strand: +

Full Sequence      

MKKKIMMSMPLLSLMLLACGGSDDENVISDNNKEPGWELVWQDEFDGETVDESVWSRITE
GTPDWKKYQSTDDRCYEKRGSSIVFYGIVNDDKDADPRDYLCGGLYTAGKKAFGPGRIEV
CARMTQAQGAWPAIWMMPFQSDKGWPYDGEIDIMEHLNMDKSVHQTLHSGYIDVDNNRDN
PLYSRQSPVADVTEFHVYGVDITEDKVVFHIDGVDKLTYPRMAVDGQYPFYQEWDLRIDM
QLGGSWVGKINARQLPVEMEVAWVKYYQWR

Enzyme Prediction     

No EC number prediction in MGYG000000055_00093.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	41	267	3.3e-49	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	4.41e-56	41	267	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	9.02e-25	43	267	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	4.79e-19	36	268	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
COG2273	BglS	5.66e-19	37	268	41	266	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd08024	GH16_CCF	1.58e-16	105	220	104	232	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU64854.1	1.34e-200	15	270	1	256
QQR10435.1	1.34e-200	15	270	1	256
ASB39072.1	1.34e-200	15	270	1	256
ASM67518.1	1.63e-85	35	270	21	258
QUU10246.1	1.63e-85	35	270	21	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	7.25e-87	35	270	27	264	ChainAAA, Beta-glycosidase [Bacteroides caccae]
6JH5_A	1.19e-27	37	268	4	232	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	8.86e-27	37	268	4	232	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
3ILN_A	1.05e-26	35	269	3	249	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
6T2O_AAA	1.97e-26	39	265	37	271	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2O_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	7.21e-35	37	268	56	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	4.06e-28	3	269	10	284	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	9.66e-22	22	268	405	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
C1IE32	1.63e-13	37	248	20	242	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
O33680	7.69e-10	99	267	302	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000064	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000055_00093.