CAZyme Information: MGYG000000055_00536

Basic Information

• Species: Muribaculum intestinale
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum intestinale
• CAZyme ID: MGYG000000055_00536
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853		95299.99	4.8738

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000055	3235245	Isolate	United Kingdom	Europe

• Gene Location: Start: 127883; End: 130444 Strand: -

Full Sequence      

MNLMKTMISAAMTAVICATVPNTAAADEGAFDLSSQRSEVQQLNPVPGKKIDHQGLIINP
TPHSIDIDRTSVYTLPATKKINDKKGKFAYTIAEVVPGGIDLSIDFGEKQAKKNGVELRP
EAYKLTVDKKGVTITGYDEAGAFYGLQTLRQILTSEIASSGTIPHMTINDWPSLSRRGVI
EGFYGAPWSHDVRLSLIDYYGKNKLNSYFFGPKDDPYHSTPHWRQPYPEPEAKKIKELVE
AANRNHVDFIWAIHPGGDIRWNEADYDSLVNKLDMMYDLGVRAFALFFDDIDGEGRNPVK
QVDLFNRLNREFVKKKGDVSNLVVCPTDYSRLWAKTDSAGALATYGRSLDKSIEVFYTGD
VVCSDLTHETMDFFNGLIRRPGFWWWNYPVSDYCRNFILQGPVYGLDTTITEEDVVGFGT
NPMEHGEASKLALYGVADYTWNTPAYNAIDNWERALSDLAPDATDAYRTFAIHSADTENG
YRRDESWETSTFSLNEYTPEKAAAMLAEFEKIEKVPATMEAKCNNQLLMKELKPWLTEFG
KLGKRGVEAIGLIEQYRAGNDSIFWTGYVDALMTPEERKAYDAHKSGTLKLQPFIENALE
DMVIGFYGRVAGNTPAIHIPIGSYPNLATRQSRLMTDRDTTNHYTSAEAQKDGDWIGLDL
GTLRKVNNIRVMQGRNSTADTDYFDNVVLQASADGHTWTDLTSPLKETYDIIWKDDNGID
ARYVRIKRLDSKRTSWTTVREFFVNPVTADNLPYSATASAVDIMLNAFDNNPDTYSTLAG
DTWNITPESGANSILVLSKTIDNPVTVDQIDAKGNIVSSDTITTPWRKINLANGTTKVNF
SSAGADICEIVVL

Enzyme Prediction     

No EC number prediction in MGYG000000055_00536.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	177	471	5e-101	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.00e-158	177	470	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	1.65e-15	112	170	67	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	5.84e-09	58	208	136	295	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	2.84e-07	646	742	27	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	7.43e-07	646	726	38	126	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB38050.1	0.0	1	853	1	853
QQR08789.1	0.0	1	853	1	853
ANU63860.1	0.0	1	853	1	853
ALB75783.1	0.0	31	853	29	852
ADV43394.1	0.0	15	851	11	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MI4_A	1.63e-140	67	708	30	689	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	2.35e-140	54	708	1	678	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
7K41_A	2.56e-140	54	708	4	681	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2VVN_A	4.28e-140	54	708	22	699	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	6.34e-140	67	708	18	677	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	2.35e-139	54	708	22	699	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	1.90e-89	101	731	108	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	3.62e-89	101	731	108	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	8.26e-53	68	782	67	844	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	5.38e-32	178	449	63	339	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000455	0.982966	0.015799	0.000275	0.000267	0.000226

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000055_00536.