CAZyme Information: MGYG000000055_01762

Basic Information

• Species: Muribaculum intestinale
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum intestinale
• CAZyme ID: MGYG000000055_01762
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MGYG000000055_20|CGC1	46484.19	7.8756

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000055	3235245	Isolate	United Kingdom	Europe

• Gene Location: Start: 7700; End: 8932 Strand: -

Full Sequence      

MMPTLLQINVTANWGSTGKIAEDIGRIAIEAGWESWIAYGRGNPHSQSKLIRIGTDFDMN
LHGLQTRLFDNHGLASNKATKHFIKQIKAINPDIIHLHNIHGYYINYEILFDYLKEWGGP
VVWTLHDCWTITGHCSHFVTANCDKWKATCYNCPLKKEYPASFLFDRSKKNHKIKKEKFT
SLDNLILIPVSNWIDNLLKESFFKFTTTRVIHNGIDLTAFCPKEPSSFNIDKYAIPANKK
YVLGVAGTWTKDKGLYDFYQLRKILSEDIGIVLVGVSDKISDNLPAGIIGIKRTESIHEL
SLLYSNAIAFINPTWADTYPTTNLESIACGTPVITYRTGGSPESVNQSIGLVVEQGDIEG
LNNAIMEIINCTNVRFKQSTCRDYALKNFDKEAHFKEYFEIYNNLINPKS

Enzyme Prediction     

No EC number prediction in MGYG000000055_01762.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03825	GT4_WcaC-like	3.22e-88	3	405	1	364	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
COG0438	RfaB	7.90e-29	83	409	75	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	2.12e-27	13	403	12	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
PRK10125	PRK10125	1.96e-21	5	405	3	405	colanic acid biosynthesis glycosyltransferase WcaC.
cd03823	GT4_ExpE7-like	1.05e-19	69	370	79	326	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU64759.1	2.11e-314	2	410	1	409
ASB39163.1	2.11e-314	2	410	1	409
QQR10308.1	2.11e-314	2	410	1	409
QCD43036.1	2.21e-160	2	406	1	396
QUU09545.1	7.85e-156	2	407	1	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVP_A	1.67e-07	210	370	182	359	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]
3OKA_A	8.44e-06	324	370	297	343	Crystalstructure of Corynebacterium glutamicum PimB' in complex with GDP-Man (triclinic crystal form) [Corynebacterium glutamicum],3OKA_B Crystal structure of Corynebacterium glutamicum PimB' in complex with GDP-Man (triclinic crystal form) [Corynebacterium glutamicum]
3OKC_A	8.67e-06	324	370	297	343	Crystalstructure of Corynebacterium glutamicum PimB' bound to GDP (orthorhombic crystal form) [Corynebacterium glutamicum],3OKP_A Crystal structure of Corynebacterium glutamicum PimB' bound to GDP-Man (orthorhombic crystal form) [Corynebacterium glutamicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71237	2.98e-14	5	405	3	405	Putative colanic acid biosynthesis glycosyl transferase WcaC OS=Escherichia coli (strain K12) OX=83333 GN=wcaC PE=4 SV=2
P39862	2.77e-07	231	375	188	342	Capsular polysaccharide biosynthesis glycosyltransferase CapM OS=Staphylococcus aureus OX=1280 GN=capM PE=3 SV=1
A0R2E2	8.83e-07	210	370	168	345	Alpha-maltose-1-phosphate synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glgM PE=1 SV=1
Q4JSW2	1.68e-06	119	405	114	406	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium jeikeium (strain K411) OX=306537 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000055_01762.