CAZyme Information: MGYG000000055_02077

Basic Information

• Species: Muribaculum intestinale
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum intestinale
• CAZyme ID: MGYG000000055_02077
• CAZy Family: GH28
• CAZyme Description: Polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MGYG000000055_28|CGC1	25225.35	6.4753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000055	3235245	Isolate	United Kingdom	Europe

• Gene Location: Start: 2595; End: 3323 Strand: -

Full Sequence      

MECTSAALPRCNVTIRNPAYAQNGDGLDIESCSNVHVTGCTFDVGDDAICIKSGKDRAGR
MRGAPTSNVLIEECKVYSGHGGFVIGSEMSGGVYNVAVRNCLFIGTDTGIKFKSTRGRGG
AVSGIHISEIKMVGIAGDAITADLYYGRKTAGQHAEPVDESTPVFDGISISGISCTGAAR
AIWLNGLPEMPIRNISISNSTISAEAGAIINNADSVTLHNVTINHSTGSRLTVTNTANLT
DR

Enzyme Prediction     

No EC number prediction in MGYG000000055_02077.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	12	220	1.6e-50	0.5692307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	3.63e-36	12	194	276	468	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	1.35e-17	12	168	123	273	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	6.24e-10	12	147	176	303	Probable polygalacturonase At3g15720
PLN02218	PLN02218	1.59e-09	12	216	230	421	polygalacturonase ADPG
PLN02188	PLN02188	9.56e-08	7	114	182	287	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08057.1	5.89e-173	1	242	1	242
ASB37321.1	5.89e-173	1	242	1	242
ARE60830.1	5.89e-173	1	242	1	242
QCD41743.1	1.01e-79	12	223	269	479
QCP72989.1	4.18e-78	13	240	270	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	7.97e-30	12	231	223	439	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	4.24e-21	12	222	238	447	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	2.27e-07	14	204	348	568	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
2IQ7_A	1.36e-06	19	186	149	297	Crystalstructure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	4.34e-29	14	209	62	268	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	2.56e-22	13	208	238	430	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q8RY29	7.61e-08	12	202	230	408	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2
B8N8M2	9.26e-08	12	181	168	327	Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgaI PE=3 SV=1
P41750	9.26e-08	12	181	168	327	Endopolygalacturonase B OS=Aspergillus flavus (strain ATCC MYA-384 / AF70) OX=1392242 GN=pgaB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000055_02077.