CAZyme Information: MGYG000000055_02556

Basic Information

• Species: Muribaculum intestinale
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum intestinale
• CAZyme ID: MGYG000000055_02556
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
134		15301.8	10.1824

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000055	3235245	Isolate	United Kingdom	Europe

• Gene Location: Start: 14368; End: 14772 Strand: +

Full Sequence      

MPQTLSASIVTTSKSHFRQAPVSSGLPDLTIPNLIAEIEKNGIKYPKIVLSQAILETGWF
KSPVCRNKHNLFGLTNPRTGKYYEFNHWTESVKAYYTKVQYRYKGGNYLLWLKKIGYAED
PGYIRAVISVLKML

Enzyme Prediction     

No EC number prediction in MGYG000000055_02556.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	34	132	3.4e-18	0.9296875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	1.42e-15	32	96	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	3.60e-11	39	132	24	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
COG1705	FlgJ	6.90e-11	39	132	59	180	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	3.47e-06	50	74	186	210	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK10356	PRK10356	0.006	49	97	154	211	protein bax.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35499.1	3.47e-94	1	134	73	206
QCD43688.1	2.08e-72	19	134	70	185
QCD34777.1	2.50e-67	11	134	78	200
ANU62956.1	1.35e-66	11	134	76	198
QQR09706.1	1.35e-66	11	134	76	198

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000055_02556.