CAZyme Information: MGYG000000056_01373

Basic Information

• Species: Muribaculum sp002358615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002358615
• CAZyme ID: MGYG000000056_01373
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792	MGYG000000056_9|CGC1	88949.37	6.4035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000056	3324937	Isolate	United Kingdom	Europe

• Gene Location: Start: 85703; End: 88081 Strand: -

Full Sequence      

MKLNLISCALTALALASSGAVSAQDRLYDNSFPLSDVTLLDSPFRHAMDLNVDVLLQYDT
DRLLAPYLKAAGLTPKGESFSCWDGLDGHIGGHYLSALAIHYAATGNEALKERMDYMLGQ
LAMCAVARGDGYVGGVPGGDDLWTALRGGDESKIWNYWVPWYNVHKMYAGLRDSWVYAGS
KVGRNLFLGMCDWGIDVISNLSDERMEAMLGNEFGGMNEVYADAYAMTGDQKYLDAARRF
THHWLYDSMLAGVDNLDNKHANTQVPKVVGFQRVAEIADDADYAKASEFFWNTVVYNRSL
SIGGNSRREHFASASDAKSYVDDREGPESCNTNNMLKLTEGLFRMSPEARYADFYERALY
NHILSTQHPHHGGYVYFTSARPGHYRVYSQPNSAMWCCVGTGMENHGKYGQFIYTHNGDS
LRVNLFIPSVLDWKEKGIKLTQRNNYPVEGVSEFTINTPEAKHFSLLLRHPGWCDAVTVK
VNGKPVKTFSKPSSYIALDREWRDGDVVTLDMPMKVTVEELPNLPSYVSILRGPVVLGAR
LEGIAPTPRIVADDSRWAHIAGGELVSVFDTPLLIGDRGKLLKKLRAMQPVGNGEFAFKV
PGLFSDKWADIVLEPFYNIHDTRYMIYWLSMTPGQYKNYMAKARKDEEMRLALDRRTVDA
VNTGEQQPEADHFMEHKSSSSGNYNGEPWRDASNGGYFSYKMKTSGADNLLLRVRYWGNE
SGNRDFDICIDDKVLASENTSGKWKKDEFVDQEYAIPSEFISGKDFVTVKFQSKKNNVAG
GIFHVRLIRPEK

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	36	537	1.1e-195	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	36	537	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.43e-121	37	537	12	500	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	5.07e-28	548	628	6	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43163.1	0.0	10	791	4	787
QCD36520.1	0.0	13	792	12	789
ADY37333.1	0.0	6	789	8	796
SCV06553.1	0.0	23	791	23	799
QRQ58640.1	0.0	23	791	23	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	8.13e-210	23	789	19	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	9.43e-203	23	789	19	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	2.19e-19	280	536	285	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.68e-18	280	536	285	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.95e-18	328	536	381	605	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999023	0.000198	0.000178	0.000161	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000056_01373.