CAZyme Information: MGYG000000056_01518

Basic Information

• Species: Muribaculum sp002358615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002358615
• CAZyme ID: MGYG000000056_01518
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748		82931.61	4.871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000056	3324937	Isolate	United Kingdom	Europe

• Gene Location: Start: 53325; End: 55571 Strand: -

Full Sequence      

MKQIIPYALAMCAAVPAQAGEIVRTDAYVWHGDTVTQGEYMATAPNDFELVSTYSAQPGY
FMPVEKSWKLKNDISSYPGLKSSNRLHNAVYNMGLDEMINAVEPDTTLRTGKEWSGVWTR
DVSYSILLSMAYLQPEASEISLTKKVNPNGRIVQDTGSGGAWPVSTDRMIWAVAAYELYK
VTGDRKWLEYIYPVIKNSIDDDLATVYDDRTGLVKGETSFIDWREQSYPKWMQTVDISQS
EALGTSVVHMQALKVLADIAGELGKKKEAEFYRERSLALAEAIDRELWLDDKGYYGMYLY
GRDNLIMNPRAETLGESLAILWDVASPERAAKITESNPTTPFGAAIFYPQISDMPAYHNN
ALWPWVGAWWTIANAKAGNEQGVLQGIGSVFRPAALFCTNKENFNLDNGDIATELNSSNM
LWCLAGNIALTHRVLFGIEFEKDRLVFHPFVPEAMADVRTLTGFRYRDAVLDITVSGYGD
RIKSFTVNGKEHAPFIPADAKGRYDVQIVMADNAIEPLKVNNVPNVKAPVTPITWIEDGV
LNWNPIEYINHYVVLRDGERIAEVNTTTYDVSQPGEYQVIGVSDGGVESFGSEPRSTRAS
FSFEMPDEGVAMTSSEISYQPAHPIKGYSGKGFVELDHNTPALKIPVRVAEGGSYALTLR
YANGNGPVNTENKCAVRSVLVDGKKAGVAVMPHRGRGNWDDWGRTNSIAVDLTPGSHVVT
VLFEPTDENMNLGTNHAVVDRLTLTRIR

Enzyme Prediction     

No EC number prediction in MGYG000000056_01518.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	2.60e-19	627	744	22	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam17389	Bac_rhamnosid6H	3.21e-09	158	296	78	222	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
cd04082	CBM35_pectate_lyase-like	9.85e-08	627	721	21	108	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
COG3408	GDB1	1.29e-06	170	474	343	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04086	CBM35_mannanase-like	2.63e-06	625	721	19	104	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE38578.1	1.68e-238	57	747	203	889
QNK61875.1	6.15e-236	67	748	215	892
AWG27199.1	3.18e-234	25	747	169	893
AKQ46615.1	1.40e-232	67	747	227	905
AFD05885.1	1.05e-228	50	747	201	891

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1V7V_A	1.50e-06	191	385	462	664	Crystalstructure of Vibrio proteolyticus chitobiose phosphorylase [Vibrio proteolyticus],1V7W_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc [Vibrio proteolyticus],1V7X_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc and sulfate [Vibrio proteolyticus]
5X7O_A	2.91e-06	587	724	821	949	Crystalstructure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7O_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7P_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7P_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7Q_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7Q_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7R_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7R_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7S_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K],5X7S_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76IQ9	8.21e-06	191	385	462	664	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000759	0.987580	0.010826	0.000331	0.000262	0.000225

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000056_01518.