CAZyme Information: MGYG000000056_01608

Basic Information

• Species: Muribaculum sp002358615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002358615
• CAZyme ID: MGYG000000056_01608
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000000056_12|CGC2	47508.03	7.5287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000056	3324937	Isolate	United Kingdom	Europe

• Gene Location: Start: 63176; End: 64426 Strand: +

Full Sequence      

MRKSIKMMLALGLLIAAATPVVSEAKGKQYNSYKGLVMAGYQGWFNTPDDGAGRGWHHYE
SRKGFTPGSCTIDLWPDMSEYKVTYPTDFTYDDGTPAHVFSSYDESTVDTHFRWMQEYGL
DGVFMQRFVAEIRNNSGRKHFNKVLASAMKAANKYERAIAVMYDLSGMRAGEEKILLDDI
KKVSKEFSLKDHDRNPSYLYHNGKPLVTVWGVGFNDRRRYGLDEAERIIDGLREMGFSVM
IGVPTHWRTLNGDTESDPRLHAIIKKCDVVMPWFVGRYNETSFSPRYSGIVPEDIAWSKA
NDVDYVPLAFPGFSWRNMPGNENSAQIKRASGDFLWMQLSQWLASGAEMLYIAMFDEIDE
GTAIFKCAKRVPVGKSRFVPVDDDIESDHYLWLVGQAGRMLRKEIPLQQKQPRRDK

Enzyme Prediction     

No EC number prediction in MGYG000000056_01608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	94	258	6.8e-18	0.4249084249084249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11576	GH99_GH71_like_2	0.0	31	404	1	378	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism. The domain may co-occur with other domains involved in the binding/processing of glycans.
cd11573	GH99_GH71_like	1.34e-38	103	397	8	282	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
cd11578	GH99_GH71_like_1	1.05e-06	81	364	5	290	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.
cd11575	GH99_GH71_like_3	1.64e-05	36	364	8	307	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.
cd11574	GH99	0.006	100	209	57	161	Glycoside hydrolase family 99, an endo-alpha-1,2-mannosidase. This family of glycoside hydrolases 99 (following the CAZY nomenclature) includes endo-alpha-1,2-mannosidase (EC 3.2.1.130), which is an important membrane-associated eukaryotic enzyme involved in the maturation of N-linked glycans. Specifically, it cleaves mannoside linkages internal to N-linked glycan chains by hydrolyzing an alpha-1,2-mannosidic bond between a glucose-substituted mannose and the remainder of the chain. The biological function and significance of the soluble bacterial orthologs, which may have obtained the genes via horizontal transfer, is not clear.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT39634.1	3.67e-215	21	404	18	400
QUT72097.1	3.67e-215	21	404	18	400
BCA51193.1	8.12e-215	22	404	1	382
ALJ40802.1	1.04e-214	21	404	18	400
QQA09893.1	1.04e-214	21	404	18	400

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000244	0.999047	0.000186	0.000182	0.000164	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000056_01608.