CAZyme Information: MGYG000000056_02148

Basic Information

• Species: Muribaculum sp002358615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002358615
• CAZyme ID: MGYG000000056_02148
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	MGYG000000056_21|CGC1	54977.61	4.2169

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000056	3324937	Isolate	United Kingdom	Europe

• Gene Location: Start: 24272; End: 25747 Strand: +

Full Sequence      

MRYQLTSINRLMLFISLLLPSIGLVSCSDDDDKFVPDGPVELTVTRDGAAVTALDFGTYG
GNVLLTLETNAYWDITVSDNADWLVLSNRSGDPTMGMPDKEDTPRYIKLTAKPLGSEPTR
SCTVTFRAADEVKTVTVTQTQPANADESGWETAYVANRNMGVGVNLWNTLDAVGDWFDPD
DIEAWETCWGQPLAKQEWFDAVAASGFKAVRVPVSWGGHMDENDIVKEPWMNRVEEVVNY
ALNAGLYCILNVHHDTGDGGWIQADKDKFDDISPRFIKLWKQIAERFNKYDHKLLFEGYN
EMLDSQNSWVEPMEGGYEAINMYAQTFVNTVRATGGNNLHRNLIVNTYGAGGSATRLDNF
VLPQDNIPGHIMLQVHNYTPAGFSNLDGSLTEDTPEEELPLWTRDFEKLLGSELDLLIEF
SNTNGVPVVIGECGAYERIKEEERAKFAEFITCYPKGKGNISVFFWGQVIDRNTCEELYP
LFIDGFLKGLN

Enzyme Prediction     

EC	3.2.1.73	3.2.1.78	3.2.1.4	3.2.1.8	3.2.1.151

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	186	466	5.2e-85	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	7.69e-48	170	466	1	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.05e-16	157	436	48	324	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	8.05e-11	52	139	7	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	0.001	73	139	1	60	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX63738.1	1.64e-100	17	484	14	473
AEX97596.1	1.58e-81	160	489	42	382
QPB75690.1	1.74e-80	22	488	8	499
AEV46038.1	2.63e-79	165	450	2	287
BCS86234.1	8.20e-76	151	471	428	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D9N_A	2.77e-76	151	436	11	284	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9N_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9P_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii],5D9P_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii]
5D9M_A	2.16e-75	151	385	11	247	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9M_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9O_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii],5D9O_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii]
3VDH_A	7.23e-73	151	436	11	284	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii],3VDH_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii]
6D2W_A	4.40e-72	151	436	434	707	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
6XSO_A	3.99e-64	150	471	19	354	GH5-4broad specificity endoglucanase from an uncultured bacterium [uncultured bacterium],6XSO_B GH5-4 broad specificity endoglucanase from an uncultured bacterium [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54937	1.08e-53	142	476	28	353	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
A7LXT7	1.58e-50	8	491	16	502	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
P23660	2.93e-50	160	489	34	362	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
Q12647	1.25e-49	158	490	30	363	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P28621	8.91e-47	158	489	47	373	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000088	0.015683	0.984222	0.000013	0.000016	0.000013

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000056_02148.