CAZyme Information: MGYG000000057_00175

Basic Information

• Species: Bacteroides sp002491635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp002491635
• CAZyme ID: MGYG000000057_00175
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	MGYG000000057_1|CGC4	98886.02	5.2853

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000057	4370351	Isolate	United Kingdom	Europe

• Gene Location: Start: 208356; End: 210923 Strand: -

Full Sequence      

MKSKLLYTFIACFSLWNAQANDTSEVLMLNQGWMFSQAGTDKWRSATVPGTVHQDLLNHQ
LLPDPFFGTNEKNIQWVENEDWEYKTTFTVTEEQLSREAAMMTFEGLDTYADVYLNGALL
LKSDNMFVGYSVPVKEVLRQGENKLHVFFRSPIKETLPQWASNGFDYPADNDHSDKKLSV
FTRKAPYSYGWDWGIRMVTSGIWRPVTLCFYDVATIDDYHVKQLSLTDRQAEISNELEIN
SISSGKEEAEIIVSCSLKDGQPLTVKQSVVLNPGINHVKIPVEIKNPVRWMPNGWGEPVL
YDFTAQVVCRGKTVASGHHRIGLRTIRLVNEKDEHGESYYFEVNGIPMFAKGANFIPNDI
LLPNMTDERYATLFRDIKEANMNVIRVWGGGTYEDNRFYDLADENGILIWQDFMFGCTVY
PADPVFLKRVSEEVDYNIKRLRNHACLAMWCGNNEILEGLKYWGWQSRYTPEVYEEFYRN
YDKLFRELLPSKVKEWDEGRSYVHTSPYFSNWGRPDSWNIGDSHNWGIWYGKKTFESSDT
EIGRFQSEFGFESFPEMKTIATFASPEDYEIESEVMTAHQKSSLGNDLIRTYMERDFIVP
EKFEDFVYVGLVLQGQGMRYCFEAHRRNRPYCMGTLYWQLNDSWPVVSWSGIDYYGNWKA
LHYQAKRAFAPLIVNPVHENGHLNVYLLSDKLEDSAGMTLEMRLMDFNGKKLQQESVKVE
APANSSVKVFGKDLDEWADEKLRKECYLLLSLKDKHGKEVARDVHYFAPTKELDLPQTMV
KSKIKVVEDGVCEVTLSASKLAKDVFVQIPYQGARFTDNFFDLLPGETHRIMITSPEIKK
GINPEILVKHIRETY

Enzyme Prediction     

No EC number prediction in MGYG000000057_00175.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	779	3.6e-106	0.7553191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.78e-106	23	835	9	786	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	3.42e-24	681	772	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	9.13e-13	780	852	4	72	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	1.99e-12	216	324	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	2.37e-12	78	455	107	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV44735.1	0.0	1	855	1	854
BAD48480.1	0.0	1	855	1	855
ANQ60193.1	0.0	1	855	1	855
CBW22258.1	0.0	1	855	1	855
BAC56899.2	0.0	1	855	1	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	0.0	19	855	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	0.0	19	855	3	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	0.0	19	855	1	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	0.0	19	855	3	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	0.0	19	855	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WAH4	1.16e-134	29	844	9	833	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	1.74e-133	29	844	9	833	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1CGA8	4.81e-133	29	844	9	833	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
A1D911	5.13e-132	29	844	9	833	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
B8NW36	6.42e-128	29	844	9	836	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000716	0.981616	0.016855	0.000290	0.000257	0.000248

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000057_00175.