CAZyme Information: MGYG000000057_00300

Basic Information

• Species: Bacteroides sp002491635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp002491635
• CAZyme ID: MGYG000000057_00300
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761	MGYG000000057_2|CGC2	86356.09	6.5483

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000057	4370351	Isolate	United Kingdom	Europe

• Gene Location: Start: 76160; End: 78445 Strand: +

Full Sequence      

MKHKETASPVSYFETGMMGMQHWQGAWIGDGKDIHYGPAPYFRKEFKTGKKVKSARAYIA
AAGLYELYINGKKIGDHCLAPLYTRFDRRNLYVAYDVTSQLQNGDNAIGVLLGNGWYNHQ
SKAVWDFDRAPWRNRPAFCLDLRIAYTDGSVETIPTDLSWRTASGAITFNSIYTGEHYDA
RLEQKGWSTPEFDDSKWRGVGYRSAPSSNVTAQQVRPIRNVKTFPAVSFRKVDEKTYIYD
FGQNMSGVTCIRLSGERGTEVRIKHGERLHPNGRLDLSNIDVYFRGDKEKEPFQTDILVL
SGEEDEFMPRFNYKGFRYVEVVADKPVELHQNSLTACFVHSDVPAVGSLESSTPLIGKLL
HAANHSYLSNLMGYPTDCPQREKNGWTGDGHFAIEAAFYNFDGITVYEKWLADHRDEQQP
NGVLPDIIPTGGWGYGTDNGLDWTSTIAIIPWNIYLFYGDSKPLSDCYENIKRYVDYVER
ISDNHLTTWGRGDWVPVKSKSNKELTSSVYFYVDTRILAAAARLFGKQADYEYYNALSEE
IKQAVNDKFLNRETGIYAEGSQTELSVPLQWKIVPEELIGKVAANLAHKVEENDFHLDVG
VLGAKAILNALSENGYAETAYKVAVQDTYPSWGWWVVNGATTLLENWDLQATRDISDNHM
MFGEIGAWFYKGLGGIFPDSAQPGFQNILLRPHFIKELKRFEARHRSPYGEIVSRWEWKG
KCVHYEVTVPANSTATLTLPDKAENVRVVKLTAGRYEFIVK

Enzyme Prediction     

No EC number prediction in MGYG000000057_00300.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	230	739	8.9e-154	0.996031746031746
CBM67	27	199	2e-41	0.9147727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.67e-132	346	673	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.29e-84	50	222	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.05e-31	230	340	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.37e-20	675	754	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT61513.1	0.0	1	761	115	875
QQA30003.1	0.0	1	761	115	875
QUT65782.1	0.0	1	761	115	875
QPH58808.1	0.0	1	761	115	875
QUU01226.1	0.0	1	761	115	875

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	8.79e-166	4	740	123	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.56e-122	39	740	302	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.23e-111	42	761	134	866	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	6.54e-122	39	740	302	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.10e-117	8	758	131	908	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.42e-110	39	739	184	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	4.80e-107	8	748	134	888	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000057_00300.