CAZyme Information: MGYG000000057_00336

Basic Information

• Species: Bacteroides sp002491635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp002491635
• CAZyme ID: MGYG000000057_00336
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738	MGYG000000057_2|CGC4	84352.86	6.7922

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000057	4370351	Isolate	United Kingdom	Europe

• Gene Location: Start: 127625; End: 129841 Strand: -

Full Sequence      

MKRKPLLLGIISLLATATIHAQEFRLQPTPQNYTVQQDDSISIPRQYRLMAGNSLNNGTA
LPLLRSLMPEEAPDAAFRIYIGTKGDKVVSSYRKRIPQKSEGYFLKIEKDRIIIAGADER
GTYYGVQTLAQLLTLDKLPLAEVADYPDVPYRGVVEGFYGTPWSQEDRIRQLDFYGRNKM
NVYLYGPKDDPYHSTPHWRKPYPAQEAERLKQLVDRARDNNVIFYWAIHPGQDIRWNEED
RELLLQKFESMYQLGVRGFAVFFDDISGEGTKADKQAELLNYIDNHFVQVKKDVAPLVMC
PTEYNKSWTKVEGGYLTTLGEKLNKDIQIMWTGNRVIATIDRPTLDFINPLIKRKAYIWW
NFPVSDYVRDHLLMGPVYGNGLDIEDGMSAFVSNPMEHAEASKISLYSVADYTWNMEKFD
SDTSWRHAIKDLMPLHAEYLETFAAHNSDLGKNGHGFRREESIRLQPALSALLKSYLEKG
EIDETAYNQVDEECRKIILSADMLLASGNENRPLIDEIRPWLTQFKLVGEYGKTVLEMMR
LPQQEKAFLPGHAHAQALQTLMTDNDARYPQGVKSGSGQLMPTFDALFEASTKQYNQRFH
TALNARAVYSPYTLESNVQQLALLPTQQKGKEGSIAPSNEVILWQAGGSLTLSMDRPRVL
ATLRIDLGTKEEGYTHFRLETSLDGKTWRNANLQSVWKGYTMQKADVEGQKVLKIRLTNT
SGSEQKVYFKAFRLTEQE

Enzyme Prediction     

No EC number prediction in MGYG000000057_00336.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	152	444	6.5e-110	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	4.66e-169	152	443	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam18344	CBM32	2.79e-27	603	666	1	64	Carbohydrate binding module family 32. This domain is found in GH84C present in Clostridium perfringens. GH84C is a beta-N-acetylglucosaminidase. This domain is a family 32 carbohydrate binding module (CBM) which preferentially recognizes the non-reducing terminus of N-acetyllactosamine.
pfam02838	Glyco_hydro_20b	2.45e-12	25	145	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	7.91e-07	23	183	133	295	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ17576.1	0.0	1	736	1	733
QUT68989.1	0.0	1	736	1	733
BBK89325.1	0.0	1	736	1	733
VTZ55497.1	0.0	1	736	1	733
QUU00212.1	0.0	1	736	1	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	1.55e-256	1	735	1	733	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2WZI_A	8.83e-256	1	735	1	733	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]
2WZH_A	8.83e-256	1	735	1	733	BtGH84D242N in complex with MeUMB-derived oxazoline [Bacteroides thetaiotaomicron VPI-5482],4AIU_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	1.09e-254	21	735	3	715	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2J47_A	1.39e-254	22	735	1	712	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	8.47e-256	1	735	1	733	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	6.00e-94	26	497	46	539	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	1.15e-93	26	497	46	539	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	9.06e-49	77	492	101	549	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q8VIJ5	1.20e-40	153	414	63	331	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000307	0.998969	0.000194	0.000183	0.000173	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000057_00336.