CAZyme Information: MGYG000000057_00669

Basic Information

• Species: Bacteroides sp002491635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp002491635
• CAZyme ID: MGYG000000057_00669
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763		83696.23	7.105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000057	4370351	Isolate	United Kingdom	Europe

• Gene Location: Start: 224656; End: 226947 Strand: -

Full Sequence      

MKHLFFKLQSFLVLLVFTAVSAYAQKSSVDMNRFIDDLMKKMTLEEKIGQLNLPVTGEIT
TGQAKSSNVAKRIRAGEVGGLFNLKGVERIRDVQKQAVEESRLGIPLLFGMDVIHGYETV
FPIPLGLSCTWDMKAVEESARIAAIESSADGICWTFSPMVDICRDARWGRVSEGNGEDPF
LGAAIAQAMVRGYQGKDMSREDEIMACVKHFALYGAGEAGRDYNTVDMSHQRMFNEYMLP
YQAAVDAGVGSAMASFNEVDGIPATGNKWLMTDVLRKQWGFDGFVVTDYTGITEMTDHGM
GDMRTVAALALNAGVDMDMVSDAFVGTLKKSLTEGKVTEEAINAACRRVLEAKYKLGLFD
NPYKYCDVKRAKKQIFTKEHRAVARKIASESLVLLKNEGNVLPLTKKGTIAVVGPLADSR
SNMPGTWSVAAVLKNATSLAEGLKAVAGGKAEILTAKGCNLMSDAEYEKRATMFGRSLHR
DNRSDKELLDEALAVAAKSDVIVAALGESSEMSGESSCRTNLEMTDTQRMLLQELLKTGK
PVVLVLFTGRPLVLNWEQANVPAILNVWFAGSEAGFAIGDVLFGDVNPSGKLTTTFPKSV
GQIPLFYNHKNTGRPLADGAWFQKFRSNYIDIDNEPLYPFGFGLSYTTFSYSDVALDKTS
MTDKGELTATVTVTNTGKRDGAEVVQLYIRDLVGSVTRPVKELKGFEKIFLKAGESKKVS
FKITPELLKFYNYNLDFVCEPGGFEVMIGRSSRDIKKAAFKLL

Enzyme Prediction     

No EC number prediction in MGYG000000057_00669.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	99	320	1.5e-70	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	30	763	33	765	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	1.35e-126	43	352	1	316	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	4.42e-112	42	461	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	7.65e-72	155	749	152	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.23e-63	392	646	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00869.1	0.0	1	763	1	763
QQA30299.1	0.0	1	763	1	763
QUT61807.1	0.0	1	763	1	763
BBK86143.1	0.0	1	763	4	766
QUT65383.1	0.0	1	763	1	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXN_A	0.0	24	762	3	751	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	0.0	26	762	4	750	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	0.0	24	762	3	751	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	3.38e-235	30	763	2	733	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	1.40e-234	28	763	1	734	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	5.66e-231	34	763	37	765	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.47e-228	34	763	37	765	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	3.43e-140	88	753	48	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	4.89e-122	25	762	30	754	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	3.35e-119	35	755	39	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000407	0.998854	0.000240	0.000156	0.000158	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000057_00669.