CAZyme Information: MGYG000000057_02567

Basic Information

• Species: Bacteroides sp002491635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp002491635
• CAZyme ID: MGYG000000057_02567
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000000057_25|CGC1	54686.42	5.117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000057	4370351	Isolate	United Kingdom	Europe

• Gene Location: Start: 28234; End: 29691 Strand: -

Full Sequence      

MNRMKKLFTLLTLLLWTLVACSNDSAADEKPGSGETDIPAGNLPMQNVARAIELIDNAVE
CYFRGTGMAMSRYYNPYTGNRSSELGSVWMYTSSIEAVNAAMKAMKTGQAKGETALYDSH
FNRYKELLTQLYDNLEYYAGTFTLTSYTQTRQWTVYGVDRGSDKGAAQVEGVLNVYDDQM
WLIRELLESYHITGEQRYLDKAEYLAEYVLDGWDCTLDEQGRQLGGITWGPGYLSKHSCS
NGPMVSPLVWLHEIYKGKSDEVTYGYVDTDNSRKLRTEKKADYYLNFAKVIYDWQKAHLL
RPDGVYDDMMGGAESPEIEYVTIDGLRYRKGTKLRDRVGPAITYNSGTMLSGAADLYRAT
SDAAYRTDLAALTDKSFVYFAKEDASKPGCYAFDISGFRNWFNGVLMRGYVDASAAHTAA
SGCIAAFQHNLDYAYDNYLYKQMLPTNLLVGWNKAEKSKNNVEAMFTFAFAAEYAVLANY
EWSKN

Enzyme Prediction     

No EC number prediction in MGYG000000057_02567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	67	464	6.5e-41	0.8770949720670391

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	9.73e-13	176	419	86	292	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	1.86e-05	176	364	92	229	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT62205.1	0.0	1	485	1	485
QQA30660.1	0.0	1	485	1	485
BBK85776.1	2.09e-317	1	485	1	484
QPH58159.1	2.09e-317	1	485	1	484
QUT64972.1	3.58e-316	4	485	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	7.66e-11	174	408	131	318	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	5.66e-10	174	408	132	319	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	1.77e-09	181	408	140	319	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4BOK_A	3.37e-09	177	368	90	233	ChainA, Alpha-1,6-mannanase [Niallia circulans]
4BOJ_A	3.42e-09	177	368	93	236	ChainA, Alpha-1,6-mannanase [Niallia circulans],4BOJ_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4BOJ_C Chain C, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000047	0.057152	0.942747	0.000022	0.000028	0.000022

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000057_02567.