CAZyme Information: MGYG000000057_02816

Basic Information

• Species: Bacteroides sp002491635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp002491635
• CAZyme ID: MGYG000000057_02816
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	MGYG000000057_30|CGC1	71122.97	5.1315

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000057	4370351	Isolate	United Kingdom	Europe

• Gene Location: Start: 11325; End: 13217 Strand: -

Full Sequence      

MRFFASMTSSLAMALAMASCSSSDVKTPEAILPIPEQKQVEWQQMETYAFIHFGLNTFND
REWGYGDSDPATFNPARLDCEQWAQTLVNSGMKGVILTAKHHDGFCLWPFQGTDYSIAHS
PYKDGKGDIVRELSDACRKYGLKFAVYLSPWDRNRADYGTPAYLDYFYAQLRDLLTNYGE
VFEVWFDGANGGDGWYGGAKDMRTIDRKNYYNYPRIYEMLDSIQPQAVIFSDGGPGCRWV
GNEKGFAGATNWSFLRKGEVFPGYDKSYELQYGHPDGNQWVPAECDVSIRPGWFYHPEED
NRVKTPEQLLDLYYRSVGHNGTLLLNFPVDRNGLIHPVDSANAVRFHQLAQQELKTNLVA
GLTPKVSNERGGHFKAAAMTDSDYDTYWATEDGVHTADVEFAFDTPRRMNRMLLQEYIPL
GQRVKSFVVEYKDKQGAWLPVRLNEETTTIGYKRLLRFETITSDALRIRFTDSRGPLCIS
SIGVYDAGQGADIAYTVPTEQLKSFSFTLPDLPEQDSALAADRNAQTTLFVEGDRLLIDL
GAERTVSSFHFLPDQAEPNRGLVATYELSVGMVPDRVNRLVKSGEFSNIRNNPVMQSVYF
TPVKARYLVLKATRMVVPGEAMGFAEIAVQ

Enzyme Prediction     

No EC number prediction in MGYG000000057_02816.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	28	342	7.3e-81	0.861271676300578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.38e-62	33	485	9	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.70e-43	62	338	69	316	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	4.22e-37	62	338	66	318	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	4.54e-08	365	482	3	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25194.1	0.0	12	630	11	629
CBW23704.1	0.0	14	630	12	626
BAD50115.1	0.0	14	630	12	626
CUA19658.1	0.0	14	630	12	626
AKA52890.1	0.0	14	630	12	626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	5.13e-168	33	629	37	583	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	5.35e-131	26	613	23	566	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3EYP_A	6.85e-111	34	485	9	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	2.41e-107	35	474	19	465	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	2.93e-105	35	474	19	465	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	4.27e-113	21	485	26	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	1.48e-110	13	485	15	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q9BTY2	3.67e-10	42	338	78	348	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q99KR8	2.57e-09	42	441	72	425	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
Q5RFI5	2.60e-09	42	338	76	346	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000557	0.999484	0.000000	0.000001	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000057_02816.