CAZyme Information: MGYG000000057_02821

Basic Information

• Species: Bacteroides sp002491635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp002491635
• CAZyme ID: MGYG000000057_02821
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294	MGYG000000057_30|CGC1	33255.89	6.7243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000057	4370351	Isolate	United Kingdom	Europe

• Gene Location: Start: 20933; End: 21817 Strand: -

Full Sequence      

MKRLILSLFAVCSLWMANAQNPAWGPQSKVVTDSIYSTVLKTHRAYTIYLPQSYDKEVDR
KYPILYLLHGMSGVNTSWFTDQRVKDVMDQLTASGEACEMIIVSPNAGGNPATCWNGYFN
MPGWAYEDFFYKEFMPYIEKTYRVVGDRQHRAVAGLSMGGGGTTSYAQRYPDLYCAAYAM
SALMNIPVSGEAAGKDPDPTNKVAVLTRSVQEHSCIKYVLEADEARKAALRTVQWFVDCG
DDDFLLDRNIEFFQAMRNAGIPCQFRVRDGGHTGEYWHSALYMCLPFVSRCFER

Enzyme Prediction     

No EC number prediction in MGYG000000057_02821.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	37	288	5.5e-56	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00756	Esterase	3.64e-26	37	281	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	2.91e-25	28	281	18	301	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	4.02e-21	36	281	75	288	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG2819	YbbA	2.74e-09	37	181	16	169	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG4099	COG4099	3.28e-06	1	181	128	301	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT65236.1	1.78e-31	36	286	154	394
QQA30430.1	2.48e-31	36	286	154	394
QUT61959.1	2.48e-31	36	286	154	394
QMI79541.1	2.48e-31	36	286	154	394
AVM58192.1	2.44e-29	36	286	154	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	2.98e-145	20	294	2	274	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	1.61e-24	26	288	128	384	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	2.62e-23	26	288	28	257	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	7.01e-23	26	288	28	257	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	4.23e-18	26	160	135	275	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	2.42e-21	26	288	47	276	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	1.99e-16	26	160	427	566	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P23553	1.23e-11	30	290	3	263	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
D5EY13	1.67e-10	48	281	518	717	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P9WM38	1.10e-07	48	273	192	426	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000517	0.996244	0.002546	0.000246	0.000217	0.000197

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000057_02821.